CATH Domain: 1vf8A02 XML data for domain: 1vf8A02

Molscript image for 1vf8A02
1vf8A02
PDB coordinates for domain 1vf8A02

PDB 1vf8, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.50 Chitinase A; domain 3
3.10.50.10 Gene3D
3.10.50.10.2
3.10.50.10.2.1
3.10.50.10.2.1.1
3.10.50.10.2.1.1.1
3.10.50.10.2.1.1.1.1

[top]
Segment boundaries for domain 1vf8A02

Chopping figure for domain 1vf8A02
DomainStart PDB ResidueStop PDB Residue
1vf8A01 1 244
1vf8A01 316 373
1vf8A02 245 315

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.10.50.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1edqA03 88.02 Chitinase ASerratia marcescens 3.10.50.10 76 15 89 2.15 2.40
1kfwA02 87.31 ChitinaseArthrobacter sp. 3.10.50.10 63 23 87 1.38 1.58
3g6mA02 85.96 ChitinaseBionectria ochroleuca 3.10.50.10 63 30 85 1.74 2.03
1jndA02 85.21 Amino sugar and nucleotide sugar metabolismChitinase [EC:3.2.1.14]Imaginal disc developmentChitinase-like protein Idgf2Imaginal disc growth factor receptor binding 3.10.50.10 94 29 75 1.85 2.45
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vf8A02
AYGHTFILSDPSKTGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vf8A02
AYGHTFILSDPSKTGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGY
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:12

Assigning to "3.10.50.10" based on similarity with "1e9lA02" (NWSI: 100, NWO: 100, SPS: 97.90, SPO: 100, RMSD: 0.29)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1vf8A02"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1vf8A02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1vf8A02"

Insertion by auto on 09 Mar 2006 06:21

Final ChopClose added based on similarity with "1e9lA" [LEE: 1, LME: 0, MR: 0, LG: 1, SS: 96.22, SI: 100, SO: 100]