CATH Domain: 1vetA00 XML data for domain: 1vetA00

Molscript image for 1vetA00
1vetA00
PDB coordinates for domain 1vetA00

PDB 1vet, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.30 Dynein light chain 2a, cytoplasmic Gene3D
3.30.450.30.5
3.30.450.30.5.1
3.30.450.30.5.1.1
3.30.450.30.5.1.1.1
3.30.450.30.5.1.1.1.1

[top]
Segment boundaries for domain 1vetA00

Chopping figure for domain 1vetA00
DomainStart PDB ResidueStop PDB Residue
1vetA00 2 123

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.450.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vetB00 84.63 Mus musculusActivation of MAPKK activityMitogen-activated protein-binding protein-interacting proteinProtein binding 3.30.450.30 118 12 90 2.87 3.15
1ifqB00 80.68 SNARE interactions in vesicular transportMus musculusVesicle-trafficking protein SEC22bGolgi membraneEndoplasmic reticulum membrane 3.30.450.50 125 8 76 2.35 3.09
3bw6A00 80.00 Vesicle fusionSNAP receptor activitySoluble fractionPalmitoyltransferase activitySynaptobrevin homolog YKT6 3.30.450.50 137 7 70 3.09 4.36
2vglM01 77.41 Huntington's diseaseEndocytosisRattus norvegicusClathrin vesicle coatAP-2 complex subunit mu-1 3.30.450.60 141 9 68 3.26 4.79
2qybA00 75.02 Membrane protein, putativeGeobacter sulfurreducens 3.30.450.40 147 9 75 3.59 4.75
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vetA00
ADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVV
QFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vetA00
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQV
VQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS
BLAST against CATH

[top]
Domain History Events (4)

Classification merge by cuff on 27 Jun 2008 15:36

COMMENT: Two domains of the same pdb structure - leave in two separate superfamilies? High SSAP score and SSAP overlap, but comparatively low % Seq Id FINAL: merge superfamily 3.30.450.100 -> 3.30.450.30

Insertion by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Insertion by auto on 06 Mar 2006 00:07

Cut based on decision in database "DomChop" on "cathdb"