CATH Domain: 1vdwA01 XML data for domain: 1vdwA01

Molscript image for 1vdwA01
1vdwA01
PDB coordinates for domain 1vdwA01

PDB 1vdw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.540 Fructose-1,6-Bisphosphatase; Chain A, domain 1
3.30.540.10 Fructose-1,6-Bisphosphatase, subunit A, domain 1 Gene3D
3.30.540.10.4
3.30.540.10.4.1
3.30.540.10.4.1.1
3.30.540.10.4.1.1.1
3.30.540.10.4.1.1.1.1

[top]
Segment boundaries for domain 1vdwA01

Chopping figure for domain 1vdwA01
DomainStart PDB ResidueStop PDB Residue
1vdwA01 2 140
1vdwA02 141 254

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.540.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lbvA01 90.83 Inositol-1-monophosphataseArchaeoglobus fulgidusStreptomycin biosynthesisMyo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]Metabolic pathways 3.30.540.10 138 27 93 1.37 1.47
3b8bA01 82.58 CysQ proteinCysQ, sulfite synthesis pathway proteinBacteroides thetaiotaomicron 3.30.540.10 138 19 86 3.49 4.05
3bigA01 81.38 Pentose phosphate pathwayGlycolysis / GluconeogenesisFructose and mannose metabolismMetabolic pathwaysFructose 1,6-bisphosphate 1-phosphatase activity 3.30.540.10 153 8 79 3.98 4.99
1ka1A01 78.13 Sulfur metabolism3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]Hyperosmotic salinity responseMethionine biosynthetic process3'(2'),5'-bisphosphate nucleotidase activity 3.30.540.10 219 21 60 3.02 4.97
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vdwA01
SVKTWRKIAIDIIRDFDHNIMPLFGNPKASETISIETKVVDKVAENIIISKFKDLGVNVVSEEIGRIDQGSDYTVVVDPL
DGSYNFINGIPFFAVSVAIFHEKDPIYAFIYEPIVERLYEGIPGKGSYLNGEKI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vdwA01
MSVKTWRKIAIDIIRDFDHNIMPLFGNPKASETISISPSGDETKVVDKVAENIIISKFKDLGVNVVSEEIGRIDQGSDYT
VVVDPLDGSYNFINGIPFFAVSVAIFHEKDPIYAFIYEPIVERLYEGIPGKGSYLNGEKI
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:06

Cut based on decision in database "DomChop" on "cathdb"