Set cath from cathlist by auto on 05 Mar 2006 19:26
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.430.10.14.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2p4gA00 | 75.79 | 3.40.430.10 | 244 | 12 | 62 | 2.98 | 4.78 |
>pdb|1vdrA00 ELVSVAALAENRVIGRDGELPWPSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSERSFSVDTAHRAAS VEEAVDIAASLDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYPEWDAAEWELDAETDHEGFTLQEWVRS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"