CATH Domain: 1vccA00 XML data for domain: 1vccA00

Molscript image for 1vccA00
1vccA00
PDB coordinates for domain 1vccA00

PDB 1vcc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.66 Viral Topoisomerase I
3.30.66.10 Viral Topoisomerase I Gene3D
3.30.66.10.1
3.30.66.10.1.1
3.30.66.10.1.1.1
3.30.66.10.1.1.1.1
3.30.66.10.1.1.1.1.1

[top]
Segment boundaries for domain 1vccA00

Chopping figure for domain 1vccA00
DomainStart PDB ResidueStop PDB Residue
1vccA00 1 77

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1vccA00
MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vccA00
MRALFYKDGKLFTDNNFLNPVSDDNPAYEVLQHVKIPTHLTDVVVYEQTWEEALTRLIFVGSDSKGRRQYFYGKMHV
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1vcc000" to "1vccA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:59

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:59

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"