CATH Domain: 1v6zA02 XML data for domain: 1v6zA02

Molscript image for 1v6zA02
1v6zA02
PDB coordinates for domain 1v6zA02

PDB 1v6z, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.7
3.40.1280.10.7.1
3.40.1280.10.7.1.1
3.40.1280.10.7.1.1.1
3.40.1280.10.7.1.1.1.1

Segment boundaries for domain 1v6zA02

Chopping figure for domain 1v6zA02
DomainStart PDB ResidueStop PDB Residue
1v6zA01 2 66
1v6zA02 67 228

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.7.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vhkA02 89.98 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 3.40.1280.10 160 33 94 1.66 1.76
1vhkB00 86.25 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 3.40.1280.10 194 32 78 1.60 2.03
1gz0B02 81.44 RRNA (guanosine-2'-O-)-methyltransferase activityEnzyme-directed rRNA 2'-O-methylationRNA methyltransferase, TrmH family [EC:2.1.1.-]Escherichia coli K-1223S rRNA (guanosine-2'-O-)-methyltransferase rlmB 3.40.1280.10 161 11 87 3.99 4.56
1x7oA02 80.92 RRNA methyltransferaseStreptomyces viridochromogenes 3.40.1280.10 166 14 86 3.88 4.47
2o3aB00 80.49 Hypothetical proteinArchaeoglobus fulgidusTRNA ribose 2'-O-methyltransferase aTrm56 3.40.1280.10 163 11 81 2.78 3.41
1vh0A00 78.66 Hypothetical proteinRibosomal RNA large subunit methyltransferase HStaphylococcus aureus 3.40.1280.10 157 5 73 3.45 4.67
1k3rA01 77.98 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.1280.10 191 17 75 2.86 3.79
1v2xA00 77.20 TRNA (guanosine-2'-O-)-methyltransferase [EC:2.1.1.34]TRNA (Gm18) methyltransferaseThermus thermophilus 3.40.1280.10 191 13 74 3.32 4.47
Displaying entries 1 to 8 (page 1 of 1)


Domain ATOM Sequence

>pdb|1v6zA02
REVGVEVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEGEGKLRRLRAVALEAAKQSGRVVVPEVLPPIPLK
AVPQVAQGLVAHVGATARVREVLDPEKPLALAVGPEGGFAEEEVALLEARGFTPVSLGRRILRAETAALALLALCTAGEG
R    

Domain COMBS Sequence

>pdb|1v6zA02
REVGVEVVLYVALLKGDKLAEVVRAATELGATRIQPLVTRHSVPKEXGEGKLRRLRAVALEAAKQSGRVVVPEVLPPIPL
KAVPQVAQGLVAHVGATARVREVLDPEKPLALAVGPEGGFAEEEVALLEARGFTPVSLGRRILRAETAALALLALCTAGE
GR    

Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:05

Cut based on decision in database "DomChop" on "cathdb"