Set cath from cathlist by auto on 05 Mar 2006 19:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1v0uA01 | 48 | 263 |
| 1v0uA02 | 6 | 47 |
| 1v0uA02 | 264 | 513 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.870.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1byrA00 | 79.63 | 3.30.870.10 | 152 | 15 | 67 | 3.02 | 4.48 |
>pdb|1v0uA01 WLLQTPGCWGDDKCADRVGTKRLLAKMTENIGNATRTVDISTLAPFPNGAFQDAIVAGLKESAAKGNKLKVRILVGAVIP SKYRDELTAKLGKAAENITLNVASMTTSKTAFSWNHSKILVVDGQSALTGGINSWKDDYLDTTHPVSDVDLALTGPAAGS AGRYLDTLWTWTCQNKSNIASVWFAASGNAGCMPTMHKDTNPKASPATG
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"