Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1v0eA01 | 245 | 312 |
| 1v0eA02 | 313 | 423 |
| 1v0eA02 | 511 | 755 |
| 1v0eA03 | 424 | 510 |
| 1v0eA04 | 756 | 910 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1v0eA04 PDNRVSRDFRYGAVPNRAVPVFFDTNGVRTVPAPMEFTGDLGLGHVTIRASTSSNIRSEVLMEGEYGFIGKSIPTDNPAG QRIIFCGGEGTSSTTGAQITLYGANNTDSRRIVYNGDEHLFQSADVKPYNDNVTALGGPSNRFTTAYLGSNPIVT