CATH Domain: 1uylA00 XML data for domain: 1uylA00

Molscript image for 1uylA00
1uylA00
PDB coordinates for domain 1uylA00

PDB 1uyl, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.1
3.30.565.10.1.1
3.30.565.10.1.1.1
3.30.565.10.1.1.1.1
3.30.565.10.1.1.1.1.1

[top]
Segment boundaries for domain 1uylA00

Chopping figure for domain 1uylA00
DomainStart PDB ResidueStop PDB Residue
1uylA00 17 224

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.565.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2iwxA00 93.87 Response to osmotic stress'de novo' protein foldingProtein targeting to mitochondrionATPase activity, coupledProtein refolding 3.30.565.10 214 70 96 1.40 1.45
2o1wA01 88.39 Canis lupus familiarisPathways in cancerProstate cancerHeat shock protein 90kDa betaNOD-like receptor signaling pathway 3.30.565.10 172 49 76 1.50 1.97
3fv5B00 78.45 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 181 16 72 3.52 4.83
3cwvA01 77.84 Myxococcus xanthus DK 1622DNA gyrase, B subunit, truncated 3.30.565.10 198 7 78 3.63 4.64
1s14B00 77.64 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 178 15 70 3.45 4.89
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1uylA00
VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGI
GMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDT
GEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1uylA00
VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGI
GMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDT
GEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"