Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1uqtA01 | 1 | 228 |
| 1uqtA01 | 437 | 455 |
| 1uqtA02 | 229 | 436 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.2000.7.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2qzsA02 | 80.21 | 3.40.50.2000 | 210 | 13 | 82 | 3.55 | 4.28 | |
![]() |
3beoA02 | 78.18 | 3.40.50.2000 | 161 | 10 | 75 | 3.17 | 4.23 |
>pdb|1uqtA02 PKEIAKQAAGPLPPKLAQLKAELKNVQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQD IRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFA GAANELTSALIVNPYDRDEVAAALDRALTMSLAERISRHAEMLDVIVK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"