Insertion by sillitoe on 06 Mar 2006 15:33
HomCheck 'Assigned T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ulvA01 | 2 | 273 |
| 1ulvA02 | 274 | 687 |
| 1ulvA03 | 688 | 773 |
| 1ulvA04 | 774 | 938 |
| 1ulvA04 | 939 | 1020 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ulvA03 PLSSPELSVTAPEALSTADSATAVVRGTTNAAKVYVSVNGTATEAPVTDGTFSLDVALTGAKNKVTVAAVAADGGTAVED RTVLYY