CATH Domain: 1ukjA01 XML data for domain: 1ukjA01

Molscript image for 1ukjA01
1ukjA01
PDB coordinates for domain 1ukjA01

PDB 1ukj, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.640 Aspartate Aminotransferase; domain 2
3.40.640.10 Type I PLP-dependent aspartate aminotransferase-like (Major domain) Gene3D
3.40.640.10.13
3.40.640.10.13.1
3.40.640.10.13.1.1
3.40.640.10.13.1.1.1
3.40.640.10.13.1.1.1.1

[top]
Segment boundaries for domain 1ukjA01

Chopping figure for domain 1ukjA01
DomainStart PDB ResidueStop PDB Residue
1ukjA01 8 262
1ukjA02 263 396

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.40.640.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qgnG01 90.39 Cystathionine gamma-synthaseNicotiana tabacum 3.40.640.10 259 34 96 1.67 1.74
1o4sA02 80.59 Tyrosine metabolismThermotoga maritimaArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Metabolic pathways 3.40.640.10 221 12 76 2.76 3.60
1gd9A02 79.67 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Pyrococcus horikoshiiMetabolic pathways 3.40.640.10 223 15 76 2.87 3.74
1fg7A01 78.89 Tyrosine metabolismHistidine metabolismMetabolic pathwaysPhenylalanine metabolismNovobiocin biosynthesis 3.40.640.10 203 16 73 2.81 3.82
1c7nA02 77.62 Treponema denticolaHemolysin 3.40.640.10 225 10 77 3.33 4.29
3d6kA02 75.68 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.640.10 237 8 77 3.67 4.76
2hoxA02 75.13 Alliin lyase 1Allium sativum 3.40.640.10 210 10 69 3.44 4.94
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ukjA01
PGFATRAIHHGYDPQDHGGALVPPVYQTATFTFPTVEYGAACFAGEQAGHFYSRISNPTLNLLEARMASLEGGEAGLALA
SGMGAITSTLWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYFESPANPNMHMA
DIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATYLSGHGDITAGIVVGSQALVDRIRLQGLKDMTGAVLS
PHDAALLMRGIKTL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ukjA01
PGFATRAIHHGYDPQDHGGALVPPVYQTATFTFPTVEYGAACFAGEQAGHFYSRISNPTLNLLEARMASLEGGEAGLALA
SGMGAITSTLWTLLRPGDEVLLGNTLYGCTFAFLHHGIGEFGVKLRHVDMADLQALEAAMTPATRVIYFESPANPNMHMA
DIAGVAKIARKHGATVVVDNTYCTPYLQRPLELGADLVVHSATXYLSGHGDITAGIVVGSQALVDRIRLQGLKDMTGAVL
SPHDAALLMRGIKTL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:27

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"