CATH Domain: 1uhgA02 XML data for domain: 1uhgA02

Molscript image for 1uhgA02
1uhgA02
PDB coordinates for domain 1uhgA02

PDB 1uhg, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.6
3.30.497.10.6.1
3.30.497.10.6.1.1
3.30.497.10.6.1.1.1
3.30.497.10.6.1.1.1.1

[top]
Segment boundaries for domain 1uhgA02

Chopping figure for domain 1uhgA02
DomainStart PDB ResidueStop PDB Residue
1uhgA01 186 284
1uhgA01 335 379
1uhgA02 1 185
1uhgA02 285 334

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.497.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wz9A01 88.44 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 26 92 1.84 1.99
1k9oI01 87.54 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 20 88 1.97 2.23
2b5tI01 86.98 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 29 86 2.59 3.01
1jmoA01 86.65 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 3.30.497.10 227 25 93 2.32 2.47
1imvA02 83.81 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 20 87 2.33 2.66
1f0cA01 80.45 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 161 24 65 3.05 4.62
1jjoC01 76.19 Mus musculusNeuroserpin 3.30.497.10 149 24 53 2.19 4.13
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1uhgA02
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDIEAQCGTSVNVHS
SLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNVL
QPSVDSQTAMVLVNAIVFKGLWEMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAELKISQAVHAAHAEI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1uhgA02
GSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRFDKLPGFGDXIEAQCGTSVNVH
SSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWVESQTNGIIRNV
LQPXSVDSQTAMVLVNAIVFKGLWEMKMEEKYNLTSVLMAMGITDVFSSSANLSGISSAEXLKISQAVHAAHAEI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"