CATH Domain: 1uhaA02 XML data for domain: 1uhaA02

Molscript image for 1uhaA02
1uhaA02
PDB coordinates for domain 1uhaA02

PDB 1uha, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.10 Gene3D
3.30.60.10.2
3.30.60.10.2.5
3.30.60.10.2.5.1
3.30.60.10.2.5.1.1
3.30.60.10.2.5.1.1.1

[top]
Segment boundaries for domain 1uhaA02

Chopping figure for domain 1uhaA02
DomainStart PDB ResidueStop PDB Residue
1uhaA01 1 40
1uhaA02 41 82

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.60.10.2.5.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wgtA04 97.70 Agglutinin isolectin 3Triticum aestivum 3.30.60.10 43 100 97 0.30 0.31
1p0t100 71.67 Tumor necrosis factor receptor superfamily member 13CTumor necrosis factor receptor superfamily, member 13CCytokine-cytokine receptor interactionIntestinal immune network for IgA productionPrimary immunodeficiency 2.10.50.10 24 12 54 2.65 4.84
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1uhaA02
DYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1uhaA02
DYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 24 Nov 2007 02:53

Assigning to "3.30.60.10" based on similarity with "1ulkB03"

Flow stage update by auto on 24 Nov 2007 02:43

No in_process hits for Domain "1uhaA02" ready to be processed

Update comment by auto on 23 Nov 2007 14:08

Domain "1uhaA02" hits Domain "1uhaA01" (45% over 95.2380952380952%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:04

Domain "1uhaA02" hits Domain "1uhaA01" (45% over 95.2380952380952%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:02

NW result present for Domain "1uhaA02"

Flow stage update by auto on 23 Nov 2007 14:01

All required files are present for Domain "1uhaA02"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "1uhaA02"

Insertion by cuff on 24 Sep 2007 13:28

nice chopping