CATH Domain: 1uddB00 XML data for domain: 1uddB00

Molscript image for 1uddB00
1uddB00
PDB coordinates for domain 1uddB00

PDB 1udd, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.910 Heme Oxygenase; Chain A
1.20.910.10 Heme Oxygenase; Chain A Gene3D
1.20.910.10.12
1.20.910.10.12.1
1.20.910.10.12.1.1
1.20.910.10.12.1.1.1
1.20.910.10.12.1.1.1.3

Segment boundaries for domain 1uddB00

Chopping figure for domain 1uddB00
DomainStart PDB ResidueStop PDB Residue
1uddB00 3 215

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.910.10.12.1.1.1.3 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qcxA00 89.59 Thiamine metabolismBacillus subtilisThiaminase-2Transcriptional activator TenA [EC:3.5.99.2] 1.20.910.10 222 25 95 1.82 1.90
1rtwB00 87.66 Pyrococcus furiosusTranscriptional activator, putative 1.20.910.10 204 26 93 1.85 1.99
1rcwB00 83.35 Chlamydia trachomatisPqqC-like proteinPyrroloquinoline-quinone synthase [EC:1.3.3.11] 1.20.910.10 210 13 94 3.36 3.56
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|1uddB00
VMITDKLRRDSEQIWKKIFEHPFVVQLYSGTLPLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAELIELARDEVTV
EVENYVKLLKELDLTLEDAIKTEPTLVNSAYMDFMLATAYKGNIIEGLTALLPCFWSYAEIAEYHKDKLRDNPIKIYREW
GKVYLSNEYLNLVGRLRKIIDSSGHSGYDRLRRIFITGSKFELAFWEMAWRGG    

Domain COMBS Sequence

>pdb|1uddB00
MRVMITDKLRRDSEQIWKKIFEHPFVVQLYSGTLPLEKFKFYVLQDFNYLVGLTRALAVISSKAEYPLMAELIELARDEV
TVEVENYVKLLKELDLTLEDAIKTEPTLVNSAYMDFMLATAYKGNIIEGLTALLPCFWSYAEIAEYHKDKLRDNPIKIYR
EWGKVYLSNEYLNLVGRLRKIIDSSGHSGYDRLRRIFITGSKFELAFWEMAWRGGDVFLEHHHHHH    

Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:22

Assigning to "1.20.910.10" based on similarity with "1uddA00" (NWSI: 100, NWO: 100, SPS: 98.21, SPO: 99, RMSD: 0.25)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1uddB00"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1uddB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1uddB00"

Insertion by auto on 08 Mar 2006 21:43

Final ChopClose added based on similarity with "1uddA" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 98.21, SI: 100, SO: 100]