CATH Domain: 1ucpA00 XML data for domain: 1ucpA00

Molscript image for 1ucpA00
1ucpA00
PDB coordinates for domain 1ucpA00

PDB 1ucp, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.9
1.10.533.10.9.1
1.10.533.10.9.1.1
1.10.533.10.9.1.1.1
1.10.533.10.9.1.1.1.1

[top]
Segment boundaries for domain 1ucpA00

Chopping figure for domain 1ucpA00
DomainStart PDB ResidueStop PDB Residue
1ucpA00 1 91

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.533.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1a1wA00 83.45 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 18 89 2.47 2.77
1ichA00 81.99 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 16 83 2.41 2.89
1ngrA00 81.65 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 8 83 2.67 3.20
1dgnA00 80.77 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 11 86 3.09 3.56
1n3kA00 77.09 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 13 63 2.40 3.76
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ucpA00
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQE
MAGQLQAATHQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ucpA00
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQE
MAGQLQAATHQ
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:58

Cut based on decision in database "DomChop" on "cathdb"