CATH Domain: 1ucdA00 XML data for domain: 1ucdA00

Molscript image for 1ucdA00
1ucdA00
PDB coordinates for domain 1ucdA00

PDB 1ucd, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.730 Ribonuclease Rh; Chain A
3.90.730.10 Ribonuclease Rh; Chain A Gene3D
3.90.730.10.1
3.90.730.10.1.1
3.90.730.10.1.1.1
3.90.730.10.1.1.1.1
3.90.730.10.1.1.1.1.1

[top]
Segment boundaries for domain 1ucdA00

Chopping figure for domain 1ucdA00
DomainStart PDB ResidueStop PDB Residue
1ucdA00 1 190

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.90.730.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1iybA00 89.66 Ribonuclease NWNicotiana glutinosa 3.90.730.10 208 38 90 2.08 2.29
1iooA00 88.46 Nicotiana alataRibonuclease S-F11 3.90.730.10 196 25 93 1.96 2.09
1iqqA00 87.56 Ribonuclease S-3Pyrus pyrifolia 3.90.730.10 200 28 93 2.42 2.60
1jy5A00 87.38 Calystegia sepiumRNase-like protein 3.90.730.10 203 26 90 3.35 3.72
1bolA00 83.51 Ribonuclease RhRhizopus niveus 3.90.730.10 222 26 76 2.31 3.02
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ucdA00
FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISHLQSQLNTLWPNVLRANNQQF
WSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVS
YLVQVVACFAQDGSTLIDCTRDTCGANFIF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ucdA00
FDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISHLQSQLNTLWPNVLRANNQQF
WSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVS
YLVQVVACFAQDGSTLIDCTRDTCGANFIF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:59

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"