CATH Domain: 1u9dA00 XML data for domain: 1u9dA00

Molscript image for 1u9dA00
1u9dA00
PDB coordinates for domain 1u9dA00

PDB 1u9d, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.4
3.30.429.10.4.1
3.30.429.10.4.1.1
3.30.429.10.4.1.1.1
3.30.429.10.4.1.1.1.1

[top]
Segment boundaries for domain 1u9dA00

Chopping figure for domain 1u9dA00
DomainStart PDB ResidueStop PDB Residue
1u9dA00 -14 107

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.429.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mwwB00 82.98 Haemophilus influenzaeUncharacterized protein HI_1388.1 3.30.429.10 118 10 86 2.28 2.63
3e6qA00 82.20 Tyrosine metabolismPseudomonas aeruginosa5-carboxymethyl-2-hydroxymuconate isomerase [EC:5.3.3.10]Benzoate degradation via hydroxylationPutative uncharacterized protein 3.30.429.10 120 9 87 4.04 4.62
3c6vA00 76.71 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 8 73 3.19 4.34
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1u9dA00
GVDLGTENLYFSSNAPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYFAEGGVYPVEVLWFGREQQTQ
DQIAQVITDQIRQLLGADSHLAVVFIPLQRTAYYLDGQHF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1u9dA00
GVDLGTENLYFSSNAXPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYFAEGGVYPXVEVLWFGREQQ
TQDQIAQVITDQIRQLLGADSHLAVVFIPLQRTAYYLDGQHF
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:58

Cut based on decision in database "DomChop" on "cathdb"