CATH Domain: 1u7bA00 XML data for domain: 1u7bA00

Molscript image for 1u7bA00
1u7bA00
PDB coordinates for domain 1u7bA00

PDB 1u7b, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.70 Box
3.70.10 Proliferating Cell Nuclear Antigen
3.70.10.10 Gene3D
3.70.10.10.5
3.70.10.10.5.1
3.70.10.10.5.1.1
3.70.10.10.5.1.1.1
3.70.10.10.5.1.1.1.1

Segment boundaries for domain 1u7bA00

Chopping figure for domain 1u7bA00
DomainStart PDB ResidueStop PDB Residue
1u7bA00 1 255

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.70.10.10.5.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1plqA00 90.20 DNA replicationProliferating cell nuclear antigenProliferating cell nuclear antigenPCNA complexProtein binding 3.70.10.10 258 35 96 1.38 1.42
1sxjH02 78.44 DNA replicationProliferating cell nuclear antigenProliferating cell nuclear antigenPCNA complexProtein binding 3.10.150.10 125 33 48 1.13 2.32
1b77A00 77.96 DNA polymerase processivity componentEnterobacteria phage RB69 3.70.10.10 228 7 82 3.43 4.16
1vpkA03 74.95 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 3.10.150.10 119 10 44 1.98 4.48
3d1gA03 74.34 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 3.10.150.10 119 11 44 2.18 4.89
1vpkA01 72.72 Thermotoga maritimaPyrimidine metabolismDNA replicationPurine metabolismMetabolic pathways 3.10.150.10 119 8 40 1.99 4.90
Displaying entries 1 to 6 (page 1 of 1)


Domain ATOM Sequence

>pdb|1u7bA00
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADM
GHLKYYLAPKI    

Domain COMBS Sequence

>pdb|1u7bA00
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS    

Domain History Events (23)

Domain assigned by auto on 15 Aug 2007 08:49

Assigning to "3.70.10.10" based on similarity with "1vyjA00"

Flow stage update by auto on 15 Aug 2007 08:44

No in_process hits for Domain "1u7bA00" ready to be processed

Update comment by auto on 15 Aug 2007 08:22

Domain "1u7bA00" hits Domain "1u76C00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 08:01

Domain "1u7bA00" hits Domain "1u76A00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:32

Domain "1u7bA00" hits Domain "1vymC00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 07:08

Domain "1u7bA00" hits Domain "1vymB00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:49

Domain "1u7bA00" hits Domain "1vymA00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:27

Domain "1u7bA00" hits Domain "1vyjI00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 06:00

Domain "1u7bA00" hits Domain "1vyjE00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:31

Domain "1u7bA00" hits Domain "1vyjG00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 05:02

Domain "1u7bA00" hits Domain "1vyjK00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:31

Domain "1u7bA00" hits Domain "1vyjA00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:56

Domain "1u7bA00" hits Domain "1vyjC00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 03:16

Domain "1u7bA00" hits Domain "1ul1B00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 02:34

Domain "1u7bA00" hits Domain "1ul1A00" (100% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 01:25

Domain "1u7bA00" hits Domain "1ul1C00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 23:57

Domain "1u7bA00" hits Domain "1axcE00" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:46

Domain "1u7bA00" hits Domain "1axcA00" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Aug 2007 22:17

Domain "1u7bA00" hits Domain "1u76E00" (100% over 100%) which is currently in process

Flow stage update by auto on 06 Aug 2007 22:17

NW result present for Domain "1u7bA00"

Flow stage update by auto on 18 Jul 2007 06:53

All required files are present for Domain "1u7bA00"

Flow stage update by auto on 16 Jul 2007 22:37

Beginning processing for Domain "1u7bA00"

Insertion by auto on 16 Jul 2007 22:10

Final ChopClose added based on similarity with "1axcA"