CATH Domain: 1u6eA02 XML data for domain: 1u6eA02

Molscript image for 1u6eA02
1u6eA02
PDB coordinates for domain 1u6eA02

PDB 1u6e, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.47 Peroxisomal Thiolase; Chain A, domain 1
3.40.47.10 Gene3D
3.40.47.10.14
3.40.47.10.14.1
3.40.47.10.14.1.1
3.40.47.10.14.1.1.1
3.40.47.10.14.1.1.1.1

Segment boundaries for domain 1u6eA02

Chopping figure for domain 1u6eA02
DomainStart PDB ResidueStop PDB Residue
1u6eA01 -10 172
1u6eA02 173 317

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.47.10.14.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tedA02 82.68 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 149 11 92 2.81 3.03
1u0mA02 81.79 Putative polyketide synthaseStreptomyces coelicolor 3.40.47.10 146 16 92 2.82 3.05
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|1u6eA02
GIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANS
RINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRM    

Domain COMBS Sequence

>pdb|1u6eA02
GIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANS
RINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRM    

Domain History Events (14)

Domain assigned by auto on 17 Oct 2008 15:41

Assigning to "3.40.47.10" based on similarity with "1hzpA02"

Flow stage update by auto on 17 Oct 2008 15:40

No in_process hits for Domain "1u6eA02" ready to be processed

Update comment by auto on 17 Oct 2008 15:36

Domain "1u6eA02" hits Domain "1m1mB02" (100% over 98.0392156862745%) which is currently in process

Update comment by auto on 17 Oct 2008 15:30

Domain "1u6eA02" hits Domain "1m1mA02" (100% over 97.4025974025974%) which is currently in process

Update comment by auto on 17 Oct 2008 15:17

Domain "1u6eA02" hits Domain "1hzpA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:14

Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:14

Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:21

Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:46

Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:11

Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1u6eA02"

Flow stage update by auto on 14 Mar 2007 15:03

All required files are present for Domain "1u6eA02"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1u6eA02"

Insertion by auto on 09 Mar 2006 12:45

Final ChopClose added based on similarity with "1hzpA" [LEE: 0, LME: 0, MR: 0, LG: 1, SS: 97.40, SI: 99.7014925373134, SO: 100]