Domain assigned by auto on 17 Oct 2008 15:41
Assigning to "3.40.47.10" based on similarity with "1hzpA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1u6eA01 | -10 | 172 |
| 1u6eA02 | 173 | 317 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.47.10.14.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1tedA02 | 82.68 | 3.40.47.10 | 149 | 11 | 92 | 2.81 | 3.03 | |
![]() |
1u0mA02 | 81.79 | 3.40.47.10 | 146 | 16 | 92 | 2.82 | 3.05 |
>pdb|1u6eA02 GIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANS RINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRM
Assigning to "3.40.47.10" based on similarity with "1hzpA02"
No in_process hits for Domain "1u6eA02" ready to be processed
Domain "1u6eA02" hits Domain "1m1mB02" (100% over 98.0392156862745%) which is currently in process
Domain "1u6eA02" hits Domain "1m1mA02" (100% over 97.4025974025974%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpA02" (100% over 100%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process
Domain "1u6eA02" hits Domain "1hzpB02" (100% over 100%) which is currently in process
NW result present for Domain "1u6eA02"
All required files are present for Domain "1u6eA02"
Beginning processing for Domain "1u6eA02"