CATH Domain: 1u6eA01 XML data for domain: 1u6eA01

Molscript image for 1u6eA01
1u6eA01
PDB coordinates for domain 1u6eA01

PDB 1u6e, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.47 Peroxisomal Thiolase; Chain A, domain 1
3.40.47.10 Gene3D
3.40.47.10.4
3.40.47.10.4.1
3.40.47.10.4.1.1
3.40.47.10.4.1.1.1
3.40.47.10.4.1.1.1.1

[top]
Segment boundaries for domain 1u6eA01

Chopping figure for domain 1u6eA01
DomainStart PDB ResidueStop PDB Residue
1u6eA01 -10 172
1u6eA02 173 317

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.47.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tedB01 82.67 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 210 27 80 2.90 3.62
1u0mA01 82.54 Putative polyketide synthaseStreptomyces coelicolor 3.40.47.10 202 24 82 2.92 3.55
1i88A01 80.70 Medicago sativaChalcone synthase 2 3.40.47.10 233 21 75 3.02 3.98
1tqyA02 79.42 3-oxoacyl-ACP synthase I [EC:2.3.1.-]Biosynthesis of type II polyketide backboneStreptomyces coelicolorActinorhodin polyketide putative beta-ketoacyl synthase 1 3.40.47.10 160 12 67 3.33 4.97
1tqyB02 78.93 Actinorhodin polyketide putative beta-ketoacyl synthase 2Biosynthesis of type II polyketide backboneStreptomyces coelicolor3-oxoacyl-ACP synthase II [EC:2.3.1.-] 3.40.47.10 148 13 63 2.95 4.67
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1u6eA01
MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDESAASMATEACRRALSNAGLSA
ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGAAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYD
RGNCFIFADGAAAVVVGETPFQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1u6eA01
MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDESAASMATEACRRALSNAGLSA
ADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSAGAAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYD
RGNCFIFADGAAAVVVGETPFQ
BLAST against CATH

[top]
Domain History Events (28)

Domain assigned by auto on 06 Mar 2008 14:58

Assigning to "3.40.47.10" based on similarity with "1hzpA01"

Flow stage update by auto on 06 Mar 2008 14:58

No in_process hits for Domain "1u6eA01" ready to be processed

Update comment by auto on 06 Mar 2008 14:56

Domain "1u6eA01" hits Domain "1ub7D01" (42.6900584795322% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:54

Domain "1u6eA01" hits Domain "1ub7B01" (42.6900584795322% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:52

Domain "1u6eA01" hits Domain "1mzsA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:50

Domain "1u6eA01" hits Domain "1mzjA01" (47.3988439306358% over 95.0549450549451%) which is currently in process

Update comment by auto on 06 Mar 2008 14:48

Domain "1u6eA01" hits Domain "1mzjB01" (47.3988439306358% over 95.0549450549451%) which is currently in process

Update comment by auto on 06 Mar 2008 14:46

Domain "1u6eA01" hits Domain "1m1mB01" (99.4413407821229% over 98.3516483516484%) which is currently in process

Update comment by auto on 06 Mar 2008 14:44

Domain "1u6eA01" hits Domain "1m1mA01" (99.4252873563218% over 95.6043956043956%) which is currently in process

Update comment by auto on 06 Mar 2008 14:43

Domain "1u6eA01" hits Domain "1hzpA01" (99.4505494505494% over 100%) which is currently in process

Update comment by auto on 06 Mar 2008 14:41

Domain "1u6eA01" hits Domain "1hzpB01" (99.4505494505494% over 100%) which is currently in process

Update comment by auto on 06 Mar 2008 14:39

Domain "1u6eA01" hits Domain "1hnhA01" (38.8235294117647% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:37

Domain "1u6eA01" hits Domain "1hnkA01" (39.1812865497076% over 93.956043956044%) which is currently in process

Update comment by auto on 06 Mar 2008 14:36

Domain "1u6eA01" hits Domain "1hnjA01" (39.1812865497076% over 93.956043956044%) which is currently in process

Update comment by auto on 06 Mar 2008 14:34

Domain "1u6eA01" hits Domain "1hn9B01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:32

Domain "1u6eA01" hits Domain "1hn9A01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:30

Domain "1u6eA01" hits Domain "1hndA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:28

Domain "1u6eA01" hits Domain "1eblA01" (38.8235294117647% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:25

Domain "1u6eA01" hits Domain "1eblB01" (38.8235294117647% over 93.4065934065934%) which is currently in process

Update comment by auto on 06 Mar 2008 14:20

Domain "1u6eA01" hits Domain "1d9bB01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 03 Sep 2007 20:14

Domain "1u6eA01" hits Domain "1d9bA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 03 Sep 2007 11:21

Domain "1u6eA01" hits Domain "1d9bA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Update comment by auto on 14 Aug 2007 22:46

Domain "1u6eA01" hits Domain "1d9bA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:11

Domain "1u6eA01" hits Domain "1d9bA01" (39.4117647058824% over 93.4065934065934%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1u6eA01"

Flow stage update by auto on 14 Mar 2007 15:03

All required files are present for Domain "1u6eA01"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1u6eA01"

Insertion by auto on 09 Mar 2006 12:45

Final ChopClose added based on similarity with "1hzpA" [LEE: 0, LME: 0, MR: 0, LG: 1, SS: 97.40, SI: 99.7014925373134, SO: 100]