CATH Domain: 1u4gA02 XML data for domain: 1u4gA02

Molscript image for 1u4gA02
1u4gA02
PDB coordinates for domain 1u4gA02

PDB 1u4g, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.390 Neutral Protease; domain 2
1.10.390.10 Neutral Protease Domain 2 Gene3D
1.10.390.10.1
1.10.390.10.1.1
1.10.390.10.1.1.1
1.10.390.10.1.1.1.1
1.10.390.10.1.1.1.1.1

[top]
Segment boundaries for domain 1u4gA02

Chopping figure for domain 1u4gA02
DomainStart PDB ResidueStop PDB Residue
1u4gA01 1 152
1u4gA02 153 298

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.390.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1keiA02 90.64 Bacillus thermoproteolyticusThermolysin 1.10.390.10 161 35 88 1.70 1.93
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1u4gA02
LIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRA
FYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1u4gA02
LIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRA
FYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:47

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"