CATH Domain: 1u2hA00 XML data for domain: 1u2hA00

Molscript image for 1u2hA00
1u2hA00
PDB coordinates for domain 1u2hA00

PDB 1u2h, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.10 Immunoglobulins Gene3D
2.60.40.10.1
2.60.40.10.1.1
2.60.40.10.1.1.1
2.60.40.10.1.1.1.1
2.60.40.10.1.1.1.1.1

[top]
Segment boundaries for domain 1u2hA00

Chopping figure for domain 1u2hA00
DomainStart PDB ResidueStop PDB Residue
1u2hA00 17 112

Structural Neighbourhood (215 entries)

There are 215 matching structural neighberhood comparisons for CATH ID 2.60.40.10.1.1.1.1.1 (SIMAX score < 5)

[1]2>>
Displaying entries 1 to 200 (page 1 of 2)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2j8hA01 93.83 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 97 31 97 0.87 0.89
1fhgA00 93.30 TelokinMeleagris gallopavo 2.60.40.10 102 33 94 0.96 1.02
1g1cA00 93.05 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 98 26 97 1.05 1.07
2rikA01 92.68 TitinOryctolagus cuniculus 2.60.40.10 96 28 98 1.18 1.19
2rikA02 92.56 TitinOryctolagus cuniculus 2.60.40.10 95 22 96 1.13 1.17
2a38B01 92.42 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 99 29 95 1.17 1.22
1cs6A04 92.36 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 90 31 93 1.07 1.14
3b43A02 91.25 TitinOryctolagus cuniculus 2.60.40.10 97 26 96 1.11 1.15
3cafA01 90.90 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 96 21 92 1.50 1.62
1koaA03 90.73 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 96 26 95 1.42 1.48
1waaC00 90.66 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 93 18 93 1.47 1.57
1bihA04 90.53 Hyalophora cecropiaHemolin 2.60.40.10 88 31 90 1.33 1.47
2j8hA02 90.51 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 22 93 1.60 1.70
1cs6A02 89.80 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 89 23 86 1.51 1.75
1qz1A03 89.62 Rattus norvegicusPrion diseasesNeural cell adhesion moleculePlasma membraneFibroblast growth factor receptor binding 2.60.40.10 95 23 93 1.96 2.09
2v44A02 89.45 Prion diseasesNeural cell adhesion moleculePlasma membraneNeuron cell-cell adhesionNeural cell adhesion molecule 2 2.60.40.10 93 24 93 1.61 1.72
2bk8A00 89.31 Structural constituent of muscleCalcium ion bindingTelethonin bindingSarcomere organizationActin filament binding 2.60.40.10 97 21 95 1.76 1.84
3bfoA00 89.26 T cell receptor signaling pathwayPositive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionNucleus 2.60.40.10 85 15 87 1.46 1.67
1cs6A03 89.24 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 98 23 91 1.74 1.89
2v44A01 89.01 Prion diseasesNeural cell adhesion moleculeNeuron cell-cell adhesionPlasma membraneNeural cell adhesion molecule 2 2.60.40.10 94 23 95 1.89 1.97
1bihA03 88.81 Hyalophora cecropiaHemolin 2.60.40.10 100 19 95 2.18 2.29
2rikA03 88.53 TitinOryctolagus cuniculus 2.60.40.10 92 26 95 1.83 1.91
2dm2A00 87.97 NucleusHomo sapiensPalladinActin filamentMuscle alpha-actinin binding 2.60.40.10 110 30 87 1.57 1.80
1gl4B00 87.67 Chondrocyte differentiationCardiac muscle tissue developmentCartilage development involved in endochondral bone morphogenesisProtein localizationBrain development 2.60.40.10 89 26 90 2.12 2.34
1rhfA01 87.26 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 89 22 87 2.80 3.20
1xauA00 87.03 Integral to plasma membraneReceptor activityNegative regulation of B cell proliferationProtein bindingMus musculus 2.60.40.10 104 15 90 2.06 2.28
2cqvA00 86.96 Myosin light chain kinase activityProtein phosphorylationHomo sapiensMyosin light chain kinase, smooth muscle 2.60.40.10 114 28 83 1.41 1.69
2ec8A04 86.67 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Extracellular spaceAcute myeloid leukemia 2.60.40.10 100 14 90 1.86 2.07
1vcaA01 86.49 Vascular cell adhesion protein 1MicrovillusPositive regulation of T cell proliferationHeterophilic cell-cell adhesionFilopodium 2.60.40.10 89 15 89 2.01 2.24
1iilG02 86.27 Cell surfacePathways in cancerNucleusPositive regulation of cell proliferationFibroblast growth factor binding 2.60.40.10 107 21 82 4.10 4.99
1olzA03 86.20 Anti-apoptosisReceptor bindingSemaphorin-4DReceptor activityCell adhesion 2.60.40.10 89 15 87 2.00 2.29
2c5dC01 86.17 Integral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiensTyrosine-protein kinase receptor UFOSignal transduction 2.60.40.10 104 17 87 2.01 2.30
2nw2A01 86.12 TRA@ proteinHomo sapiens 2.60.40.10 103 13 85 2.29 2.68
2ec8A03 86.05 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 104 22 88 2.09 2.36
1witA00 86.01 Caenorhabditis elegansProtein ZK617.1b, partially confirmed by transcript evidenceLocomotionReproduction 2.60.40.10 93 17 96 2.41 2.49
1l6zA02 85.92 Mus musculusCarcinoembryonic antigen-related cell adhesion molecule 1 2.60.40.10 96 23 92 2.20 2.37
2gy5A04 85.89 MicrovillusCell surfaceTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transductionProtein binding 2.60.40.10 99 12 91 2.47 2.69
1pewA00 85.83 Ig lambda chain V-VI region SUTHomo sapiens 2.60.40.10 108 17 86 2.20 2.55
1gsmA01 85.72 Membrane fractionMucosal vascular addressin cell adhesion molecule 1Intestinal immune network for IgA productionCell adhesionHomo sapiens 2.60.40.10 90 17 90 3.73 4.12
2ialA01 85.69 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 108 16 85 2.14 2.51
1u3hA00 85.69 Mus musculusTRAV14-3 2.60.40.10 110 19 83 2.14 2.56
2ny1B01 85.56 Zinc ion bindingMaintenance of protein location in cellT-cell surface glycoprotein CD4Signal transductionT cell receptor signaling pathway 2.60.40.10 98 13 82 2.30 2.78
1nctA00 85.50 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 98 22 96 2.42 2.50
1cs6A01 85.35 Cell adhesion molecule bindingContactin 2Neuron cell-cell adhesionGallus gallusContactin-2 2.60.40.10 105 20 88 2.82 3.18
1ogaD01 85.34 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 109 18 84 2.16 2.56
1f97A02 85.32 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 105 18 87 2.45 2.80
1bihA01 85.24 Hyalophora cecropiaHemolin 2.60.40.10 97 15 94 2.38 2.51
1f2qA02 85.22 High affinity immunoglobulin epsilon receptor subunit alphaIntegral to plasma membraneHomo sapiensFc receptor, IgE, high affinity I, alpha polypeptideAsthma 2.60.40.10 90 14 88 3.37 3.81
2ak4D01 85.15 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 114 15 81 1.95 2.39
3d9aL01 85.08 2.60.40.10 107 20 86 2.24 2.58
2otuA00 84.96 2.60.40.10 115 12 79 2.00 2.53
1rhfA02 84.94 Integral to plasma membraneTyrosine-protein kinase receptor TYRO3Cell adhesionTYRO3 protein tyrosine kinase 3 [EC:2.7.10.1]Signal transduction 2.60.40.10 84 19 85 2.51 2.94
1lp9E01 84.94 2.60.40.10 113 15 82 2.08 2.53
1eajB00 84.92 Integral to plasma membraneReceptor activityCoxsackievirus and adenovirus receptorViral myocarditisCoxsackievirus and adenovirus receptor 2.60.40.10 120 14 77 1.96 2.53
1oaqL00 84.90 2.60.40.10 110 14 83 2.59 3.10
2fcbA02 84.89 Low affinity immunoglobulin gamma Fc region receptor II-bHomo sapiensImmune responseSignal transduction 2.60.40.10 87 12 86 3.52 4.07
2gy5A02 84.75 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 2.60.40.10 90 16 89 3.57 3.99
1cczA01 84.72 Homo sapiensLymphocyte function-associated antigen 3Protein binding 2.60.40.10 93 13 84 2.60 3.08
1f97A01 84.61 Mus musculusEpithelial cell differentiationJunctional adhesion molecule ACell adhesionTight junction 2.60.40.10 102 18 86 1.99 2.31
1kgcE01 84.57 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 112 22 81 2.09 2.57
1x9qA01 84.54 2.60.40.10 111 16 81 2.22 2.71
1kgcD01 84.40 Homo sapiensT-cell receptor alpha chain C region 2.60.40.10 111 16 81 2.74 3.34
3bp6A00 84.39 Mus musculusExternal side of plasma membraneProgrammed cell death protein 1Programmed cell death protein 1T cell receptor signaling pathway 2.60.40.10 111 18 81 2.24 2.76
2q20A00 84.30 2.60.40.10 105 11 86 2.17 2.50
1mjuL01 84.29 2.60.40.10 113 21 82 2.16 2.62
2q87C00 84.24 Homo sapiensCMRF35-like molecule 8CD300 antigen 2.60.40.10 106 12 81 2.32 2.86
1qfoC00 84.24 Mus musculusSialoadhesinProtein binding 2.60.40.10 114 13 79 2.31 2.89
1p53A03 84.23 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 83 16 83 2.15 2.58
1hkfA00 84.17 Integral to plasma membraneNatural cytotoxicity triggering receptor 2Cellular defense responseNatural killer cell mediated cytotoxicitySignal transduction 2.60.40.10 108 11 81 2.97 3.65
1fltX00 83.98 Vascular endothelial growth factor receptor 1Integral to plasma membraneGrowth factor bindingVascular endothelial growth factor receptor activityFemale pregnancy 2.60.40.10 95 15 92 2.82 3.04
2q8bH01 83.96 2.60.40.10 112 12 80 2.35 2.92
1i1rA01 83.89 Jak-STAT signaling pathwayOncostatin-M receptor complexResponse to cytokine stimulusPositive regulation of osteoblast differentiationPositive regulation of tyrosine phosphorylation of Stat1 protein 2.60.40.10 100 7 91 4.21 4.63
2e9wA01 83.86 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaExtracellular space 2.60.40.10 84 17 77 2.63 3.41
1tvdA00 83.79 Homo sapiensHDV103S1 2.60.40.10 116 19 80 2.08 2.59
1dr9A01 83.79 Type I diabetes mellitusAutoimmune thyroid diseaseIntestinal immune network for IgA productionAllograft rejectionT-lymphocyte activation antigen CD80 2.60.40.10 105 14 80 2.44 3.05
2qsqB01 83.77 Carcinoembryonic antigen-related cell adhesion molecule 5Integral to plasma membraneHomo sapiensBasolateral plasma membrane 2.60.40.10 108 16 79 2.10 2.64
2vxtH01 83.69 2.60.40.10 113 10 79 2.25 2.83
1yc7A00 83.55 2.60.40.10 116 18 78 2.22 2.83
2ifgA02 83.51 High affinity nerve growth factor receptorIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase activityHomo sapiens 2.60.40.10 90 18 90 3.24 3.58
2ij0C00 83.48 Homo sapiensT cell receptor beta variable 20/OR9-2 2.60.40.10 118 18 78 2.16 2.74
1mfaH01 83.42 2.60.40.10 97 10 77 2.08 2.69
1ogaE01 83.26 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 111 16 81 2.40 2.96
1itbB03 83.25 Platelet-derived growth factor receptor bindingIntegral to plasma membraneHematopoietic cell lineageInterleukin 1 receptor, type IInterleukin-1-mediated signaling pathway 2.60.40.10 112 17 85 2.43 2.83
1ugnA01 83.20 Homo sapiensLeukocyte immunoglobulin-like receptor subfamily B member 1Integral to membraneResponse to virusProtein phosphatase 1 binding 2.60.40.10 95 11 93 3.42 3.65
1neuA00 83.13 Rattus norvegicusMyelin protein P0 2.60.40.10 115 12 78 2.14 2.73
1q0xL02 83.03 Mus musculusIg lambda-1 chain V regionProtein binding 2.60.40.10 100 15 85 2.63 3.09
2aepL01 83.00 2.60.40.10 119 18 78 2.25 2.88
1mjuH01 82.99 2.60.40.10 115 10 80 2.12 2.65
1hxmA01 82.96 2.60.40.10 121 17 77 2.56 3.30
1pd6A00 82.80 Myosin-binding protein C, cardiac-typeHomo sapiensVentricular cardiac muscle tissue morphogenesisStriated muscle myosin thick filamentStructural constituent of muscle 2.60.40.10 94 20 92 3.81 4.11
1nkrA01 82.76 Integral to plasma membraneReceptor activityHomo sapiensNatural killer cell inhibitory signaling pathwayImmune response 2.60.40.10 97 11 85 3.05 3.56
3d9aH01 82.73 2.60.40.10 112 14 80 2.34 2.91
1smoB00 82.73 Receptor activityTriggering receptor expressed on myeloid cells 1Homo sapiensHumoral immune response 2.60.40.10 110 18 79 3.20 4.05
3d9aL02 82.67 2.60.40.10 102 14 83 2.60 3.12
1hxmB01 82.62 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 125 14 75 2.22 2.95
1p53A01 82.57 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 98 9 89 2.81 3.13
2p45B00 82.53 2.60.40.10 116 15 78 3.73 4.75
1t0pB00 82.53 Integral to plasma membraneIntercellular adhesion molecule 3Homo sapiensIntercellular adhesion molecule 3Cell adhesion molecules (CAMs) 2.60.40.10 86 6 89 3.03 3.38
1nezH00 82.50 T-cell surface glycoprotein CD8 alpha chainProtein homodimerization activityHematopoietic cell lineageCD8A antigen, alpha polypeptideT cell receptor signaling pathway 2.60.40.10 120 15 78 2.39 3.05
1itbB01 82.49 Platelet-derived growth factor receptor bindingIntegral to plasma membraneHematopoietic cell lineageInterleukin 1 receptor, type IInterleukin-1-mediated signaling pathway 2.60.40.10 92 10 89 3.79 4.23
2g5rA00 82.48 Sialic acid-binding Ig-like lectin 7Sialic acid binding Ig-like lectin 7Receptor activityIntegral to plasma membraneHomo sapiens 2.60.40.10 113 16 81 2.79 3.43
1t2jA00 82.47 Homo sapiensSingle chain Fv 2.60.40.10 116 14 79 3.41 4.30
1uctA01 82.45 Immunoglobulin alpha Fc receptorIntegral to plasma membraneCD89 antigenHomo sapiensImmune response 2.60.40.10 91 12 85 3.15 3.69
1pkoA00 82.38 Rattus norvegicusMyelin-oligodendrocyte glycoproteinPositive regulation of MyD88-dependent toll-like receptor signaling pathway 2.60.40.10 123 18 77 2.70 3.50
3esuF02 82.33 2.60.40.10 106 9 76 2.52 3.30
1iamA01 82.18 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 83 9 85 2.94 3.44
1fv1B02 82.18 HLA class II histocompatibility antigen, DR beta 5 chainMajor histocompatibility complex, class IIType I diabetes mellitusAutoimmune thyroid diseaseIntestinal immune network for IgA production 2.60.40.10 98 14 85 3.80 4.43
2hp4A00 82.13 T-cell surface glycoprotein CD8 alpha chainCD8A antigen, alpha polypeptideHematopoietic cell lineagePrimary immunodeficiencyHomo sapiens 2.60.40.10 112 18 81 2.50 3.08
1bihA02 82.13 Hyalophora cecropiaHemolin 2.60.40.10 106 16 83 2.74 3.30
1ncwH01 82.08 2.60.40.10 119 12 77 2.40 3.10
1n26A02 82.05 Positive regulation of chemokine productionPositive regulation of smooth muscle cell proliferationJak-STAT signaling pathwayAcute-phase responsePositive regulation of osteoblast differentiation 2.60.40.10 78 19 72 3.22 4.42
1o0vA01 81.97 Homo sapiensIg epsilon chain C region 2.60.40.10 102 13 86 3.23 3.74
1uvqA02 81.92 2.60.40.10 99 17 84 2.87 3.38
1ncnA00 81.88 T-lymphocyte activation antigen CD86Positive regulation of cell proliferationHomo sapiensImmune responseProtein binding 2.60.40.10 110 14 76 2.29 3.00
1nkrA02 81.87 Receptor activityIntegral to plasma membraneHomo sapiensImmune responseNatural killer cell inhibitory signaling pathway 2.60.40.10 98 12 87 3.61 4.11
2fcbA01 81.86 Low affinity immunoglobulin gamma Fc region receptor II-bHomo sapiensImmune responseSignal transduction 2.60.40.10 86 19 83 3.33 4.00
1dr9A02 81.85 Type I diabetes mellitusIntestinal immune network for IgA productionAutoimmune thyroid diseaseAllograft rejectionT-lymphocyte activation antigen CD80 2.60.40.10 95 12 88 3.25 3.67
1l0qA02 81.75 Methanosarcina mazeiORF492 2.60.40.670 90 7 83 3.03 3.64
2gy5A01 81.72 Cell surfaceMicrovillusIntegral to plasma membraneTransmembrane receptor protein tyrosine kinase signaling pathwaySignal transduction 2.60.40.10 99 9 90 3.46 3.81
1l6xA01 81.69 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 100 13 81 2.90 3.58
1dn0D02 81.69 2.60.40.10 94 10 82 2.61 3.17
1xiwA00 81.67 Chagas diseaseHematopoietic cell lineageReceptor signaling protein activitySH3 domain bindingT cell receptor signaling pathway 2.60.40.10 91 13 84 3.67 4.35
1ypzF01 81.58 2.60.40.10 123 14 76 2.80 3.66
3dbxA02 81.43 CD1-2 antigenGallus gallus 2.60.40.10 99 14 84 3.12 3.68
2ec8A05 81.32 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Extracellular spaceAcute myeloid leukemia 2.60.40.10 81 14 77 3.65 4.74
1f6fB01 81.29 Rattus norvegicusProlactin receptorProlactin receptor activity 2.60.40.10 97 7 86 3.63 4.19
1w8oA02 81.15 Micromonospora viridifaciensSialidase 2.60.40.10 102 13 86 3.94 4.57
1cczA02 81.10 Homo sapiensLymphocyte function-associated antigen 3Protein binding 2.60.40.10 78 7 81 3.26 4.01
1cidA01 80.83 Rattus norvegicusT-cell surface glycoprotein CD4Hematopoietic cell lineageT cell receptor signaling pathwayAntigen processing and presentation 2.60.40.10 106 14 81 3.10 3.82
3h9yB01 80.75 Homo sapiensIg epsilon chain C region 2.60.40.10 101 9 83 3.14 3.78
3cmgA04 80.73 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.1560 87 6 85 3.41 3.99
3h9yA02 80.66 Homo sapiensIg epsilon chain C region 2.60.40.10 108 16 80 3.10 3.85
1l6xA02 80.51 Ig gamma-1 chain C regionHomo sapiensProtein bindingAntigen binding 2.60.40.10 106 14 80 3.23 4.03
1mcpH02 80.48 Mus musculusIg heavy chain V region M603 2.60.40.10 99 11 85 3.59 4.18
2bc4A02 80.46 HLA class II histocompatibility antigen, DM alpha chainHomo sapiensProtein binding 2.60.40.10 109 11 78 3.26 4.13
1cwvA02 80.39 InvasinYersinia pseudotuberculosis 2.60.40.920 97 8 87 3.76 4.29
1k5nA02 80.13 HLA class I histocompatibility antigen, B-27 alpha chainMembrane fractionDefense responseHomo sapiens 2.60.40.10 95 11 85 3.51 4.11
3g08A02 80.11 Antigen-presenting glycoprotein CD1d1Endogenous lipid antigen bindingPositive thymic T cell selectionAntigen processing and presentation, exogenous lipid antigen via MHC class IbProtein binding 2.60.40.10 88 14 77 3.02 3.92
2brqA00 80.08 Transcription factor bindingReceptor clusteringActin filament bindingActin cytoskeleton reorganizationPositive regulation of transcription factor import into nucleus 2.60.40.10 94 3 82 3.20 3.89
1k5nB00 80.07 Antigen processing and presentationBeta-2-microglobulinHomo sapiensBeta-2-microglobulinProtein binding 2.60.40.10 100 11 85 3.90 4.59
3k3qA00 80.00 2.60.40.10 137 15 67 2.86 4.21
1v05A00 80.00 Plasma membraneFilamin-CHomo sapiens 2.60.40.10 96 7 82 3.04 3.69
2vxvH02 79.96 2.60.40.10 101 8 85 3.33 3.91
1f00I01 79.88 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 7 90 4.04 4.46
1seqH02 79.84 Rattus norvegicusIghg protein 2.60.40.10 98 8 84 3.19 3.77
1fo0B00 79.81 2.60.40.10 112 16 80 3.40 4.23
1bquA01 79.74 Oncostatin-M receptor complexJak-STAT signaling pathwayResponse to cytokine stimulusPositive regulation of tyrosine phosphorylation of Stat1 proteinPositive regulation of osteoblast differentiation 2.60.40.10 100 9 90 3.72 4.13
1iarB01 79.72 Jak-STAT signaling pathwayInterleukin 4 receptorIntegral to plasma membraneInterleukin-4 receptor activityHematopoietic cell lineage 2.60.40.10 96 9 85 4.06 4.75
1cwvA03 79.71 InvasinYersinia pseudotuberculosis 2.60.40.920 102 8 85 3.59 4.21
1je6A02 79.70 Response to heatMHC class I polypeptide-related sequence BGamma-delta T cell activationImmune response-activating cell surface receptor signaling pathwayResponse to retinoic acid 2.60.40.10 89 10 81 3.37 4.15
1ow0A02 79.63 Homo sapiensProtein bindingIg alpha-1 chain C region 2.60.40.10 109 13 79 3.12 3.91
2nqcA00 79.62 Plasma membraneFilamin-CHomo sapiens 2.60.40.10 97 7 89 4.13 4.60
1hxmB02 79.59 Homo sapiensT-cell receptor gamma-2 chain C region 2.60.40.10 105 8 79 2.87 3.63
1vcaA02 79.38 Vascular cell adhesion protein 1MicrovillusPositive regulation of T cell proliferationMembrane to membrane dockingLeukocyte transendothelial migration 2.60.40.10 110 12 79 3.47 4.39
1ix2A00 79.35 Escherichia coliCopper resistance protein C 2.60.40.1220 97 10 88 3.77 4.25
1ulvA03 79.34 GlucodextranaseArthrobacter globiformis 2.60.40.1560 86 12 85 3.43 4.02
2ny1B02 79.33 Zinc ion bindingMaintenance of protein location in cellT-cell surface glycoprotein CD4Signal transductionT cell receptor signaling pathway 2.60.40.10 75 16 75 3.03 4.04
3b4nA01 79.27 Erwinia chrysanthemiEndo-pectate lyase 2.60.40.10 88 9 82 3.59 4.36
1jbjA01 79.20 T cell receptor signaling pathwayPositive regulation of interferon-gamma productionPositive regulation of T cell anergyChagas diseasePositive regulation of alpha-beta T cell proliferation 2.60.40.10 89 13 81 3.93 4.84
1u2cA01 79.05 Epithelial tube branching involved in lung morphogenesisDilated cardiomyopathyECM-receptor interactionHypertrophic cardiomyopathy (HCM)Sarcolemma 2.60.40.10 103 11 86 3.80 4.40
1g0dA04 79.05 Protein-glutamine gamma-glutamyltransferase 2Pagrus major 2.60.40.10 97 4 85 3.74 4.37
1q72H02 78.89 2.60.40.10 89 10 80 3.33 4.15
2qfpA01 78.85 Fe(3+)-Zn(2+) purple acid phosphatasePhaseolus vulgaris 2.60.40.380 97 6 83 3.74 4.48
1p53A02 78.79 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 69 18 64 2.78 4.30
1n26A01 78.68 Positive regulation of chemokine productionJak-STAT signaling pathwayPositive regulation of smooth muscle cell proliferationResponse to cytokine stimulusAcute-phase response 2.60.40.10 107 7 82 3.99 4.85
1svbA04 78.61 Genome polyproteinTick-borne encephalitis virus (WESTERN SUBTYPE) 2.60.40.350 96 10 79 3.71 4.69
1fyhB01 78.54 Jak-STAT signaling pathwayInterferon gamma receptor 1Integral to plasma membraneChagas diseaseInterferon-gamma receptor activity 2.60.40.10 97 9 84 3.62 4.28
1im3D00 78.49 Unique short US2 glycoproteinHuman herpesvirus 5 strain AD169 2.60.40.1200 95 8 88 3.71 4.19
1t7vA02 78.43 Cell adhesionHomo sapiensZinc-alpha-2-glycoprotein 2.60.40.10 90 12 84 3.51 4.16
1cvrA03 78.43 Gingipain R [EC:3.4.22.37]Porphyromonas gingivalisGingipain R2 2.60.40.10 83 8 83 3.20 3.84
1edqA01 78.37 Chitinase ASerratia marcescens 2.60.40.10 107 12 80 3.65 4.54
3edfA01 78.18 CyclomaltodextrinaseFlavobacterium sp. 92 2.60.40.10 90 7 84 3.97 4.71
2rb8A00 78.14 TenascinCell adhesionSyndecan bindingECM-receptor interactionTenascin 2.60.40.10 93 4 88 3.83 4.33
3b9eA01 78.11 Vibrio harveyiChitinase A 2.60.40.10 110 8 76 3.32 4.35
1u58A02 78.11 Murine cytomegalovirus (strain K181)Immunoevasin 2.60.40.10 100 7 81 3.64 4.49
1iamA02 78.11 Leukocyte migrationAdhesion to symbiontHeterophilic cell-cell adhesionRegulation of leukocyte mediated cytotoxicityT cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell 2.60.40.10 102 13 84 4.17 4.95
2bnuB02 78.09 T-cell receptor beta-1 chain C regionHomo sapiensProtein binding 2.60.40.10 126 15 68 3.15 4.62
1eerC01 78.09 Jak-STAT signaling pathwayIntegral to plasma membraneHematopoietic cell lineageErythropoietin receptor activityErythropoietin receptor 2.60.40.10 97 5 83 4.06 4.86
3fruA02 78.08 IgG receptor FcRn large subunit p51Beta-2-microglobulin bindingRattus norvegicusHumoral immune responseIgG receptor activity 2.60.40.10 92 16 86 4.09 4.73
1dceA02 78.04 Rattus norvegicusRab geranylgeranyltransferase activityProtein geranylgeranyltransferase type II [EC:2.5.1.60]Geranylgeranyl transferase type-2 subunit alpha 2.60.40.1130 103 6 80 3.50 4.34
1fnfA01 78.01 FibronectinER-Golgi intermediate compartmentPeptide cross-linkingFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 5 87 3.84 4.39
1fnhA03 77.84 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 89 10 85 3.61 4.23
1tdqA02 77.79 Nervous system developmentRattus norvegicusTenascinFocal adhesionProteinaceous extracellular matrix 2.60.40.10 90 6 85 3.68 4.31
3d9aH02 77.65 2.60.40.10 97 9 86 3.93 4.54
1b4rA00 77.62 Integral to plasma membranePolycystin-1Homophilic cell adhesionHomo sapiensProtein binding 2.60.40.670 80 12 81 3.91 4.81
2hftA01 77.50 Positive regulation of endothelial cell proliferationTissue factorPositive regulation of platelet-derived growth factor receptor signaling pathwayPositive regulation of angiogenesisProtease binding 2.60.40.10 103 3 81 4.06 4.98
1fnhA01 77.49 FibronectinER-Golgi intermediate compartmentPeptide cross-linkingFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 90 7 82 3.58 4.35
2ec8A02 77.38 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Acute myeloid leukemiaProtein binding 2.60.40.10 87 10 88 3.52 3.98
1j8kA00 77.37 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 94 4 89 3.72 4.15
2nziA03 77.33 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 2.60.40.10 94 9 84 3.67 4.35
1k3iA03 77.31 Gibberella zeaeGalactose oxidase 2.60.40.10 97 9 86 4.22 4.87
1k85A00 77.28 Bacillus circulansChitinase A1 2.60.40.10 88 10 84 3.72 4.41
1fnfA02 76.99 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 87 5 81 3.58 4.41
2jllA04 76.98 Prion diseasesNeural cell adhesion moleculePlasma membraneNeuron cell-cell adhesionNeural cell adhesion molecule 2 2.60.40.10 91 9 86 3.83 4.43
1fnfA03 76.98 FibronectinPeptide cross-linkingER-Golgi intermediate compartmentFibrinogen complexSubstrate adhesion-dependent cell spreading 2.60.40.10 89 3 84 3.75 4.44
1ex0A03 76.79 Protein-glutamine gamma-glutamyltransferase activityHomo sapiensCoagulation factor XIII A chainBlood coagulation 2.60.40.10 114 9 74 3.64 4.88
1ehxA00 76.75 Scaffolding proteinClostridium cellulolyticum 2.60.40.10 94 7 83 4.07 4.88
1qg3A01 76.64 Homo sapiensIntegrin beta-4Protein bindingIntegrin complex 2.60.40.10 91 2 84 3.54 4.20
1n26A03 76.59 Positive regulation of chemokine productionJak-STAT signaling pathwayPositive regulation of smooth muscle cell proliferationResponse to cytokine stimulusAcute-phase response 2.60.40.10 104 8 81 3.82 4.67
2cumA00 76.58 Collagen metabolic processElastic fiber assemblyIntracellularHomo sapiensTenascin-X 2.60.40.10 105 6 81 3.77 4.60
[1]2>>
Displaying entries 1 to 200 (page 1 of 2)


[top]
Domain ATOM Sequence 

>pdb|1u2hA00
KAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAV
NEYGARQCEARLEVRG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1u2hA00
GSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCK
AVNEYGARQCEARLEVRGE
BLAST against CATH

[top]
Domain History Events (49)

Domain assigned by cuff on 24 Jul 2008 16:29

same superfamily

Domain assignment manual match h by yan on 22 Jul 2008 16:11

excellent superposition, >30% sequence identity, belong to the immunoglobulin super family informed by paper

Homcheck review by yan on 22 Jul 2008 16:11

excellent superposition, >30% sequence identity, belong to the immunoglobulin super family informed by paper

Flow stage update by yan on 22 Jul 2008 16:11

excellent superposition, >30% sequence identity, belong to the immunoglobulin super family informed by paper

Homcheck allotment by yan on 22 Jul 2008 16:04

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by yan on 22 Jul 2008 16:04

User 'yan' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 27 Jan 2008 23:39

Domain "1u2hA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 27 Jan 2008 23:39

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1u2hA00

Flow stage update by auto on 27 Jan 2008 20:59

Retrieved PRC_PFAMCATH results for job ID SID8679277461469272 and results inserted.

Domain scan prc pfamcath by auto on 27 Jan 2008 20:59

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 724 results for 1u2hA00

Update comment by auto on 26 Jan 2008 21:10

PRC_PFAMCATH job SID8679277461469272 is not yet finished.

Flow stage update by auto on 26 Jan 2008 21:02

The entry "1u2hA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 26 Jan 2008 21:02

The entry "1u2hA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Jan 2008 20:47

Retrieved SSAP results for job ID SID1250389256319936 and results inserted.

Domain scan ssap cath by auto on 26 Jan 2008 20:43

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2221 results for 1u2hA00

Update comment by auto on 24 Jan 2008 06:56

SSAP job SID1250389256319936 is not yet finished.

Ssap cath submit by auto on 24 Jan 2008 06:37

The entry "1u2hA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 24 Jan 2008 06:37

The entry "1u2hA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 24 Jan 2008 06:17

Retrieved PRC results for job ID SID9417524096421164 and inserted them into the database.

Domain scan prc cath by auto on 24 Jan 2008 06:17

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 138 results for 1u2hA00

Update comment by auto on 24 Jan 2008 00:03

PRC job SID9417524096421164 is not yet finished.

Flow stage update by auto on 23 Jan 2008 23:56

The entry "1u2hA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 23 Jan 2008 23:56

The entry "1u2hA00" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Jan 2008 23:44

Retrieved HMM(SAM) results for job ID SID3516070597245220 and inserted them into the database.

Domain scan sam cath by auto on 23 Jan 2008 23:44

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 83 results for 1u2hA00

Update comment by auto on 23 Jan 2008 17:37

HMM(SAM) job SID3516070597245220 is not yet finished.

Sam cath submit by auto on 23 Jan 2008 17:29

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 23 Jan 2008 17:29

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 23 Jan 2008 11:42

Unable to retrieve "1u2hA00" HMM(SAM) results for job "SID3869527867625984"

Update comment by auto on 23 Jan 2008 05:48

HMM(SAM) job SID3869527867625984 is not yet finished.

Sam cath submit by auto on 23 Jan 2008 05:39

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 23 Jan 2008 05:39

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2008 23:37

Unable to retrieve "1u2hA00" HMM(SAM) results for job "SID2876613204399364"

Update comment by auto on 22 Jan 2008 20:39

HMM(SAM) job SID2876613204399364 is not yet finished.

Sam cath submit by auto on 22 Jan 2008 20:31

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2008 20:31

The entry "1u2hA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Jan 2008 20:25

Retrieved "1u2hA00" CATHEDRAL results for job ID SID7999145066169856 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Jan 2008 20:25

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 189 results for 1u2hA00

Update comment by auto on 22 Jan 2008 14:32

"1u2hA00" CATHEDRAL job SID7999145066169856 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2008 14:29

The entry "1u2hA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2008 14:29

The entry "1u2hA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2008 14:29

ScanList with 11661 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1u2hA00.scanlist" for "1u2hA00"

Write scan list by auto on 22 Jan 2008 14:28

Writing ScanList containing 11661 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1u2hA00.scanlist" for domain "1u2hA00"

Flow stage update by auto on 06 Aug 2007 22:22

No satisfactory AssignClose result found.

Flow stage update by auto on 06 Aug 2007 22:17

No in_process hits for Domain "1u2hA00" ready to be processed

Flow stage update by auto on 06 Aug 2007 22:17

NW result present for Domain "1u2hA00"

Flow stage update by auto on 03 Aug 2007 22:37

All required files are present for Domain "1u2hA00"

Flow stage update by auto on 03 Aug 2007 15:19

Beginning processing for Domain "1u2hA00"

Insertion by cuff on 03 Aug 2007 11:59

nice choppping Dr Marsden. ;)