CATH Domain: 1u1sA00 XML data for domain: 1u1sA00

Molscript image for 1u1sA00
1u1sA00
PDB coordinates for domain 1u1sA00

PDB 1u1s, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.100 Gene3D
2.30.30.100.2
2.30.30.100.2.1
2.30.30.100.2.1.1
2.30.30.100.2.1.1.1
2.30.30.100.2.1.1.1.1

Segment boundaries for domain 1u1sA00

Chopping figure for domain 1u1sA00
DomainStart PDB ResidueStop PDB Residue
1u1sA00 6 71

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 2.30.30.100.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mgqF00 88.32 Methanothermobacter thermautotrophicus str. Delta HSmall nuclear ribonucleoproteinPutative snRNP Sm-like protein 2.30.30.100 70 18 81 1.54 1.89
1b34B00 87.74 SpliceosomeSpliceosomal complexSmall nuclear ribonucleoprotein Sm D2Homo sapiensSmall nuclear ribonucleoprotein D2 2.30.30.100 74 19 89 3.68 4.13
1d3bC00 87.56 SpliceosomeSystemic lupus erythematosusSmall nuclear ribonucleoprotein Sm D3Small nuclear ribonucleoprotein D3Spliceosomal complex 2.30.30.100 71 9 81 1.45 1.77
1m5q101 87.30 Pyrobaculum aerophilumSmall nuclear ribonucleoprotein homolog (Sm-like) 2.30.30.100 67 21 85 1.63 1.92
1n9rB00 87.09 Protein bindingNuclear mRNA splicing, via spliceosomeSmall nuclear ribonucleoprotein FSmall nuclear ribonucleoprotein FU5 snRNP 2.30.30.100 69 12 79 2.01 2.52
1ljoA00 86.05 Archaeoglobus fulgidusSnRNP, putative 2.30.30.100 75 12 77 1.60 2.07
1b34A00 85.64 SpliceosomeSystemic lupus erythematosusSmall nuclear ribonucleoprotein Sm D1RNA bindingProtein binding 2.30.30.100 80 21 78 1.75 2.22
1d3bB00 84.35 Small nuclear ribonucleoprotein-associated proteins B and B'Spliceosomal complexU7 snRNPHomo sapiensProtein binding 2.30.30.100 81 10 71 3.18 4.44
1ib8A02 84.18 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 2.30.30.180 67 6 86 2.56 2.96
2k57A00 83.90 Pseudomonas syringae pv. phaseolicola 1448ALipoprotein, putative 2.30.30.100 55 18 75 1.98 2.61
1biaA03 81.32 Biotin metabolismDNA bindingBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Bifunctional protein birABiotin-[acetyl-CoA-carboxylase] ligase activity 2.30.30.100 47 14 68 1.81 2.65
1sf9A02 78.40 Bacillus subtilisUncharacterized protein yfhH 2.30.30.340 54 5 74 3.10 4.18
1mmdA01 76.47 ActomyosinMyosin II complexActin-myosin filament slidingProtein localizationActin filament binding 2.30.30.360 48 14 62 3.03 4.88
Displaying entries 1 to 13 (page 1 of 1)


Domain ATOM Sequence

>pdb|1u1sA00
SLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLP    

Domain COMBS Sequence

>pdb|1u1sA00
MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPSGDQPAEPG
NA    

Domain History Events (13)

Domain assigned by auto on 02 Nov 2006 03:27

Assigning to "2.30.30.100" based on similarity with "1u1sE00"

Flow stage update by auto on 02 Nov 2006 03:16

No in_process hits for Domain "1u1sA00" ready to be processed

Update comment by auto on 01 Nov 2006 21:56

Domain "1u1sA00" hits Domain "1u1tB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "1u1sA00" hits Domain "1u1sB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "1u1sA00" hits Domain "1u1sE00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1u1sA00" hits Domain "1u1sE00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "1u1sA00" hits Domain "1u1sE00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:08

Domain "1u1sA00" hits Domain "1u1sE00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Oct 2006 18:11

Domain "1u1sA00" hits Domain "1u1sE00" (100% over 100%) which is currently in process

Flow stage update by auto on 20 Oct 2006 18:11

NW result present for Domain "1u1sA00"

Flow stage update by auto on 17 Oct 2006 17:34

All required files are present for Domain "1u1sA00"

Flow stage update by auto on 16 Oct 2006 14:36

Beginning processing for Domain "1u1sA00"

Insertion by auto on 16 Oct 2006 14:21

Final ChopClose added based on similarity with "1u1sC"