CATH Domain: 1u02A02 XML data for domain: 1u02A02

Molscript image for 1u02A02
1u02A02
PDB coordinates for domain 1u02A02

PDB 1u02, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.1020 Trehalose-6-phosphate phosphatase related protein; domain 2 Gene3D
3.30.70.1020.1
3.30.70.1020.1.1
3.30.70.1020.1.1.1
3.30.70.1020.1.1.1.1
3.30.70.1020.1.1.1.1.1

[top]
Segment boundaries for domain 1u02A02

Chopping figure for domain 1u02A02
DomainStart PDB ResidueStop PDB Residue
1u02A01 2 81
1u02A01 158 230
1u02A02 82 157

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.70.1020.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wr8A02 81.37 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 8 84 3.28 3.86
1s2oA02 80.62 Synechocystis sp. PCC 6803Slr0953 protein 3.90.1070.10 71 11 90 3.94 4.36
1wqgA02 80.03 Ribosome recycling factorMycobacterium tuberculosisRibosome-recycling factor 3.30.1360.40 75 9 82 3.36 4.06
3gygA02 78.93 Bacillus subtilisNTD biosynthesis operon putative hydrolase ntdB 3.30.70.1410 86 9 74 3.49 4.69
2j8sA07 77.07 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1440 94 6 71 3.45 4.84
1vr6A01 76.29 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 6 58 2.48 4.23
1xxaC00 75.24 Transcriptional regulator of arginine metabolismArginine repressorEscherichia coli K-12Plasmid recombination 3.30.1360.40 73 12 73 3.63 4.91
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1u02A02
SDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLGADKPKLRSRIEEIARIFGVETYYGKIIELRVP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1u02A02
SDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLYHLGLXGADXKPKLRSRIEEIARIFGVETYYGKXIIELRVP
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Insertion by auto on 05 Mar 2006 23:56

Cut based on decision in database "DomChop" on "cathdb"