CATH Domain: 1tzzB01 XML data for domain: 1tzzB01

Molscript image for 1tzzB01
1tzzB01
PDB coordinates for domain 1tzzB01

PDB 1tzz, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.19
3.30.390.10.19.1
3.30.390.10.19.1.1
3.30.390.10.19.1.1.1
3.30.390.10.19.1.1.1.1

[top]
Segment boundaries for domain 1tzzB01

Chopping figure for domain 1tzzB01
DomainStart PDB ResidueStop PDB Residue
1tzzB01 2005 2132
1tzzB02 2133 2392

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.390.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bjsA01 86.36 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 21 86 2.80 3.23
1nu5A01 86.19 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 13 80 2.21 2.74
2ovlA01 85.48 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 16 82 2.67 3.22
1tkkA01 85.22 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 11 81 2.65 3.25
2qq6B01 84.54 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 15 78 2.71 3.47
2oqyA01 81.29 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 17 72 2.89 3.98
1jpdX01 81.11 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 11 73 2.91 3.94
2hzgB01 80.72 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 15 72 3.16 4.34
2nqlA01 80.36 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 21 63 2.63 4.14
2pgwA01 78.93 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 17 68 3.05 4.48
1yeyD01 78.46 Xanthomonas campestris pv. campestrisRTS beta protein 3.30.390.10 172 15 62 2.90 4.66
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tzzB01
SVRIVDVREITKPISSTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADPKKLLNEAGDNLDP
DKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tzzB01
GSHMSVRIVDVREITKPISSPIRNAYIDFTKMTTSLVAVVTDVVREGKRVVGYGFNSNGRYGQGGLIRERFASRILEADP
KKLLNEAGDNLDPDKVWAAMMINEKPGGHGERSVAVGTIDMAVWDAVAKIAG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:35

Assigning to "3.30.390.10" based on similarity with "1tzzA01" (NWSI: 100, NWO: 100, SPS: 98.51, SPO: 99, RMSD: 0.23)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tzzB01"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tzzB01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tzzB01"

Insertion by auto on 09 Mar 2006 11:40

Final ChopClose added based on similarity with "1tzzA" [LEE: 1, LME: 0, MR: 0, LG: 4, SS: 98.21, SI: 100, SO: 100]