CATH Domain: 1tzkC01 XML data for domain: 1tzkC01

Molscript image for 1tzkC01
1tzkC01
PDB coordinates for domain 1tzkC01

PDB 1tzk, Chain C, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1100 Gene3D
3.40.50.1100.8
3.40.50.1100.8.1
3.40.50.1100.8.1.1
3.40.50.1100.8.1.1.1
3.40.50.1100.8.1.1.1.1

[top]
Segment boundaries for domain 1tzkC01

Chopping figure for domain 1tzkC01
DomainStart PDB ResidueStop PDB Residue
1tzkC01 1 45
1tzkC01 165 338
1tzkC02 66 164

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.50.1100.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j0aA01 88.51 1-aminocyclopropane-1-carboxylate deaminase [EC:3.5.99.7]Pyrococcus horikoshiiPropanoate metabolismPutative 1-aminocyclopropane-1-carboxylate deaminase 3.40.50.1100 220 28 94 1.96 2.07
1p5jA01 80.51 L-serine ammonia-lyase activityProtein homodimerization activityGlycine, serine and threonine metabolismMetabolic pathwaysPyruvate biosynthetic process 3.40.50.1100 223 14 82 3.38 4.07
1tdjA01 80.40 Glycine, serine and threonine metabolismValine, leucine and isoleucine biosynthesisMetabolic pathwaysThreonine dehydratase biosyntheticL-threonine ammonia-lyase activity 3.40.50.1100 223 18 80 2.86 3.56
1v7cA01 79.33 Threonine synthase [EC:4.2.3.1]Vitamin B6 metabolismGlycine, serine and threonine metabolismThreonine synthaseMetabolic pathways 3.40.50.1100 254 19 75 3.11 4.14
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tzkC01
MNLQRFPRYPLTFGPTPIQPLARLSKHLGGKVHLYAKREDCNSGLHPLGGLGFVGFAEEVRAQEAEKFDYVVVCSVTGST
QAGMVVGFAADGRADRVIGVDASAKPAQTREQITRIARQTAEKVGLERDIMRADVVLDERFAGPEYGLPNEGTLEAIRLC
ARTEGMLTDPVYEGKSMHGMIEMVRNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tzkC01
MNLQRFPRYPLTFGPTPIQPLARLSKHLGGKVHLYAKREDCNSGLHPLGGLGFVGFAEEVRAQEAELGFKFDYVVVCSVT
GSTQAGMVVGFAADGRADRVIGVDASAKPAQTREQITRIARQTAEKVGLERDIMRADVVLDERFAGPEYGLPNEGTLEAI
RLCARTEGMLTDPVYEGKSMHGMIEMVRNGEFPEGSRVLYAHLGGVPALNGYSFIFRDG
BLAST against CATH

[top]
Domain History Events (18)

Domain assigned by auto on 12 Jan 2007 11:46

Assigning to "3.40.50.1100" based on similarity with "1tzkD01"

Flow stage update by auto on 12 Jan 2007 11:44

No in_process hits for Domain "1tzkC01" ready to be processed

Update comment by auto on 12 Jan 2007 07:34

Domain "1tzkC01" hits Domain "1tzkB01" (100% over 100%) which is currently in process

Update comment by auto on 12 Jan 2007 03:36

Domain "1tzkC01" hits Domain "1tzkA01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 23:39

Domain "1tzkC01" hits Domain "1tzkD01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 19:35

Domain "1tzkC01" hits Domain "1tz2D01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 15:46

Domain "1tzkC01" hits Domain "1tz2C01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 11:51

Domain "1tzkC01" hits Domain "1tz2A01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 07:38

Domain "1tzkC01" hits Domain "1tz2B01" (100% over 100%) which is currently in process

Update comment by auto on 11 Jan 2007 03:36

Domain "1tzkC01" hits Domain "1tyzC01" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 23:42

Domain "1tzkC01" hits Domain "1tyzB01" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 19:37

Domain "1tzkC01" hits Domain "1tyzD01" (100% over 100%) which is currently in process

Update comment by auto on 10 Jan 2007 15:45

Domain "1tzkC01" hits Domain "1tyzA01" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2007 15:42

Domain "1tzkC01" hits Domain "1tyzA01" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Jan 2007 15:42

NW result present for Domain "1tzkC01"

Flow stage update by auto on 24 Dec 2006 15:32

All required files are present for Domain "1tzkC01"

Flow stage update by auto on 23 Dec 2006 23:33

Beginning processing for Domain "1tzkC01"

Insertion by auto on 23 Dec 2006 23:25

Final ChopClose added based on similarity with "1rqxA"