CATH Domain: 1twfI02 XML data for domain: 1twfI02

Molscript image for 1twfI02
1twfI02
PDB coordinates for domain 1twfI02

PDB 1twf, Chain I, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.8
2.20.25.10.8.1
2.20.25.10.8.1.1
2.20.25.10.8.1.1.1
2.20.25.10.8.1.1.1.1

[top]
Segment boundaries for domain 1twfI02

Chopping figure for domain 1twfI02
DomainStart PDB ResidueStop PDB Residue
1twfI01 1 46
1twfI02 47 122

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.20.25.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tfiA00 78.20 Transcription from RNA polymerase II promoterTranscription elongation factor S-IITranscription elongation factor A protein 1General RNA polymerase II transcription factor activityHomo sapiens 2.20.25.10 50 26 64 2.34 3.63
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1twfI02
ELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1twfI02
ELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:32

Assigning to "2.20.25.10" based on similarity with "1i6hI01" (NWSI: 100, NWO: 100, SPS: 94.94, SPO: 97, RMSD: 0.72)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1twfI02"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1twfI02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1twfI02"

Insertion by auto on 09 Mar 2006 10:33

Final ChopClose added based on similarity with "1i3qI" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 94.05, SI: 100, SO: 100]