CATH Domain: 1twfI01 XML data for domain: 1twfI01

Molscript image for 1twfI01
1twfI01
PDB coordinates for domain 1twfI01

PDB 1twf, Chain I, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.5
2.20.25.10.5.1
2.20.25.10.5.1.1
2.20.25.10.5.1.1.1
2.20.25.10.5.1.1.1.1

[top]
Segment boundaries for domain 1twfI01

Chopping figure for domain 1twfI01
DomainStart PDB ResidueStop PDB Residue
1twfI01 1 46
1twfI02 47 122

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.20.25.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cngA01 82.42 NUDIX hydrolaseNitrosomonas europaea 2.20.70.10 34 17 73 1.83 2.48
1tfiA00 81.80 Transcription from RNA polymerase II promoterTranscription elongation factor S-IITranscription elongation factor A protein 1General RNA polymerase II transcription factor activityHomo sapiens 2.20.25.10 50 10 78 3.84 4.92
3d6wB02 73.96 Methyl-accepting/DNA response regulator, putativeBacillus cereus ATCC 10987 2.20.25.10 38 7 67 3.11 4.61
1lqlA01 73.31 Mycoplasma pneumoniaeUncharacterized protein MG427 homolog 2.20.25.10 26 0 56 2.75 4.87
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1twfI01
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1twfI01
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRH
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:32

Assigning to "2.20.25.10" based on similarity with "1i6hI02" (NWSI: 100, NWO: 100, SPS: 95.41, SPO: 97, RMSD: 0.43)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1twfI01"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1twfI01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1twfI01"

Insertion by auto on 09 Mar 2006 10:33

Final ChopClose added based on similarity with "1i3qI" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 94.05, SI: 100, SO: 100]