CATH Domain: 1tuhA00 XML data for domain: 1tuhA00

Molscript image for 1tuhA00
1tuhA00
PDB coordinates for domain 1tuhA00

PDB 1tuh, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.17
3.10.450.50.17.1
3.10.450.50.17.1.1
3.10.450.50.17.1.1.1
3.10.450.50.17.1.1.1.1

[top]
Segment boundaries for domain 1tuhA00

Chopping figure for domain 1tuhA00
DomainStart PDB ResidueStop PDB Residue
1tuhA00 19 149

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.10.450.50.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cnxA00 85.05 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 16 84 2.37 2.81
3bb9B00 84.08 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 8 83 2.66 3.20
2ux0B00 83.45 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 9 82 3.71 4.50
3blzA00 81.68 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 8 84 3.16 3.73
2owpA00 81.05 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 9 81 3.17 3.88
1of5B00 80.79 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 9 86 3.18 3.69
3b7cA00 80.42 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 7 80 3.11 3.84
2jq5A00 76.94 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 15 74 3.44 4.65
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tuhA00
NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRYGGETGGTFKAVLLHVLKSDD
GRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHFYDLYAWDEFWR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tuhA00
NEAEQNAETVRRGYAAFNSGDMKTLTELFDENASWHTPGRSRIAGDHKGREAIFAQFGRYGGETGGTFKAVLLHVLKSDD
GRVIGIHRNTAERGGKRLDVGCCIVFEFKNGRVIDGREHFYDLYAWDEFWR
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:55

Cut based on decision in database "DomChop" on "cathdb"