CATH Domain: 1tu5B02 XML data for domain: 1tu5B02

Molscript image for 1tu5B02
1tu5B02
PDB coordinates for domain 1tu5B02

PDB 1tu5, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.16
3.10.450.40.16.1
3.10.450.40.16.1.1
3.10.450.40.16.1.1.1
3.10.450.40.16.1.1.1.1

[top]
Segment boundaries for domain 1tu5B02

Chopping figure for domain 1tu5B02
DomainStart PDB ResidueStop PDB Residue
1tu5B01 57 170
1tu5B02 171 292
1tu5B03 321 717

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.10.450.40.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nnvA01 72.78 Hypothetical proteinHaemophilus influenzaeUPF0263 protein HI_1450 3.10.450.140 100 6 72 3.53 4.84
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tu5B02
LLREYLDIDQMIFNRELPQAAGVLHHCCSYKQGGQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLHPVGLELLVDH
KALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tu5B02
LLREYLDIDQMIFNRELPQAAGVLHHCCSYKQGGQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLHPVGLELLVDH
KALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPD
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:31

Assigning to "3.10.450.40" based on similarity with "1tu5A02" (NWSI: 99.1803278688525, NWO: 95.2755905511811, SPS: 98.34, SPO: 95, RMSD: 0.16)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tu5B02"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tu5B02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tu5B02"

Insertion by auto on 05 Mar 2006 23:55

Cut based on decision in database "DomChop" on "cathdb"