CATH Domain: 1tt8A00 XML data for domain: 1tt8A00

Molscript image for 1tt8A00
1tt8A00
PDB coordinates for domain 1tt8A00

PDB 1tt8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1410 Chorismate lyase
3.40.1410.10 Chorismate lyase Gene3D
3.40.1410.10.1
3.40.1410.10.1.1
3.40.1410.10.1.1.1
3.40.1410.10.1.1.1.1
3.40.1410.10.1.1.1.1.1

[top]
Segment boundaries for domain 1tt8A00

Chopping figure for domain 1tt8A00
DomainStart PDB ResidueStop PDB Residue
1tt8A00 1 164

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.40.1410.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2nwiB00 81.29 Archaeoglobus fulgidusPutative uncharacterized protein 3.40.1410.10 151 16 81 2.83 3.46
2pkhB01 78.76 Pseudomonas syringae pv. tomatoHistidine utilization repressorGntR family transcriptional regulator, histidine utilization repressor 3.40.1410.10 129 10 67 2.51 3.74
3bwgC02 78.66 GntR family transcriptional regulator, transcriptional regulator of bglABacillus subtilisUncharacterized HTH-type transcriptional regulator yydK 3.40.1410.10 155 7 78 3.28 4.17
3ddvB01 77.30 GntR family transcriptional regulatorTranscriptional regulator, GntR familyEnterococcus faecalis 3.40.1410.10 137 8 68 3.21 4.66
2p19A01 77.01 Corynebacterium glutamicumBacterial regulatory proteins, gntR family 3.40.1410.10 130 10 65 2.84 4.31
2oggA01 75.97 GntR family transcriptional regulator, trehalose operon transcriptional repressorBacillus subtilisTrehalose operon transcriptional repressor 3.40.1410.10 133 9 68 3.08 4.47
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tt8A00
SHPALTQLRALRYSKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILL
SADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPA
SPLY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tt8A00
SHPALTQLRALRYSKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILL
SADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPA
SPLY
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:31

Assigning to "3.40.1410.10" based on similarity with "1fw9A00" (NWSI: 100, NWO: 100, SPS: 99.45, SPO: 100, RMSD: 0.14)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tt8A00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tt8A00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tt8A00"

Insertion by auto on 09 Mar 2006 10:13

Final ChopClose added based on similarity with "1fw9A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 99.45, SI: 100, SO: 100]