CATH Domain: 1trlA00 XML data for domain: 1trlA00

Molscript image for 1trlA00
1trlA00
PDB coordinates for domain 1trlA00

PDB 1trl, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.390 Neutral Protease; domain 2
1.10.390.10 Neutral Protease Domain 2 Gene3D
1.10.390.10.3
1.10.390.10.3.1
1.10.390.10.3.1.1
1.10.390.10.3.1.1.1
1.10.390.10.3.1.1.1.1

[top]
Segment boundaries for domain 1trlA00

Chopping figure for domain 1trlA00
DomainStart PDB ResidueStop PDB Residue
1trlA00 255 316

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.390.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hlvA02 80.84 Centromere protein BMajor centromere autoantigen BHomo sapiensChromosome, centromeric region 1.10.10.60 60 8 82 4.11 5.00
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1trlA00
VVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1trlA00
VVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVGVK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"