CATH Domain: 1tqyA02 XML data for domain: 1tqyA02

Molscript image for 1tqyA02
1tqyA02
PDB coordinates for domain 1tqyA02

PDB 1tqy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.47 Peroxisomal Thiolase; Chain A, domain 1
3.40.47.10 Gene3D
3.40.47.10.12
3.40.47.10.12.1
3.40.47.10.12.1.1
3.40.47.10.12.1.1.1
3.40.47.10.12.1.1.1.1

[top]
Segment boundaries for domain 1tqyA02

Chopping figure for domain 1tqyA02
DomainStart PDB ResidueStop PDB Residue
1tqyA01 3 263
1tqyA02 264 423

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.47.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tqyB02 90.42 Actinorhodin polyketide putative beta-ketoacyl synthase 2Biosynthesis of type II polyketide backboneStreptomyces coelicolor3-oxoacyl-ACP synthase II [EC:2.3.1.-] 3.40.47.10 148 30 92 2.30 2.49
1u6eA02 79.63 3-oxoacyl-[acyl-carrier-protein] synthase 3Beta-ketoacyl ACP synthase [EC:2.3.1.-]Mycobacterium tuberculosis 3.40.47.10 148 14 74 3.55 4.77
1tedA02 78.67 Chalcone/stilbene synthase family proteinMycobacterium tuberculosis 3.40.47.10 149 10 75 2.91 3.88
1wdkC01 76.82 Pseudomonas fragi3-ketoacyl-CoA thiolase 3.40.47.10 213 8 59 2.86 4.83
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tqyA02
SGYATRCNAYHMTGLKADGREMAETIRVALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSM
VGHSLGAIGSLEIAACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLRDAETAGAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tqyA02
SGYATRCNAYHMTGLKADGREMAETIRVALDESRTDATDIDYINAHGSGTRQNDRHETAAYKRALGEHARRTPVSSIKSM
VGHSLGAIGSLEIAACVLALEHGVVPPTANLRTSDPECDLDYVPLEARERKLRSVLTVGSGFGGFQSAMVLRDAETAGAA
A
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 24 Nov 2007 03:14

Assigning to "3.40.47.10" based on similarity with "1tqyC02"

Flow stage update by auto on 24 Nov 2007 03:10

No in_process hits for Domain "1tqyA02" ready to be processed

Update comment by auto on 24 Nov 2007 03:01

Domain "1tqyA02" hits Domain "1tqyE02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 02:45

Domain "1tqyA02" hits Domain "1tqyG02" (100% over 100%) which is currently in process

Update comment by auto on 23 Nov 2007 14:09

Domain "1tqyA02" hits Domain "1tqyC02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:04

Domain "1tqyA02" hits Domain "1tqyC02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:02

NW result present for Domain "1tqyA02"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "1tqyA02"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "1tqyA02"

Insertion by auto on 12 Nov 2007 21:00

Final ChopClose added based on similarity with "1tqyC"