CATH Domain: 1tp6A00 XML data for domain: 1tp6A00

Molscript image for 1tp6A00
1tp6A00
PDB coordinates for domain 1tp6A00

PDB 1tp6, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.9
3.10.450.50.9.1
3.10.450.50.9.1.1
3.10.450.50.9.1.1.1
3.10.450.50.9.1.1.1.1

[top]
Segment boundaries for domain 1tp6A00

Chopping figure for domain 1tp6A00
DomainStart PDB ResidueStop PDB Residue
1tp6A00 3 128

Structural Neighbourhood (21 entries)

There are 21 matching structural neighberhood comparisons for CATH ID 3.10.450.50.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 21 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ux0B00 85.54 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 15 84 1.78 2.11
3cnxA00 85.34 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 10 83 1.92 2.29
3b8lA01 84.26 Novosphingobium aromaticivorans DSM 12444Putative uncharacterized protein 3.10.450.50 135 12 84 2.48 2.94
1of5B00 83.14 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 5 90 2.74 3.02
1m98A02 83.14 Arthrospira maximaOrange carotenoid-binding protein 3.10.450.50 128 8 86 2.57 2.96
1tuhA00 83.04 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 10 83 2.43 2.92
3blzA00 82.65 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 4 87 2.95 3.38
2r4iA00 82.52 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 7 85 2.61 3.04
1jkgA00 82.06 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 7 80 2.33 2.89
3dm8A00 82.00 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 9 82 2.77 3.36
2owpA00 81.96 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 9 88 3.12 3.51
3bb9B00 81.89 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 13 88 3.03 3.44
1ohpA00 81.57 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 12 85 3.64 4.25
2rgqB00 81.53 3.10.450.50 124 14 89 3.23 3.60
3b7cA00 81.19 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 8 84 3.24 3.85
1gy6A00 81.14 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 7 91 3.44 3.77
2jq5A00 79.02 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 6 79 3.39 4.25
2bmoB00 78.40 Oxygenase-beta NBDOComamonas sp. JS765Protein binding 3.10.450.50 194 5 60 2.23 3.67
3cu3A00 78.35 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 18 74 3.24 4.36
1jkgB00 76.68 Nuclear RNA export factor 1Homo sapiensProtein binding 3.10.450.50 180 3 63 2.31 3.65
1q40D00 73.91 MRNA export factor MEX67Candida albicans 3.10.450.50 169 3 63 3.03 4.74
[1]
Displaying entries 1 to 21 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tp6A00
CAYRREIHHAHVAIRDWLAGDSRADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASG
VDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tp6A00
MTCAYRREIHHAHVAIRDWLAGDSRADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLA
SGVDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 23:55

Cut based on decision in database "DomChop" on "cathdb"