Set cath from cathlist by auto on 05 Mar 2006 19:22
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1toaA01 | 32 | 174 |
| 1toaA02 | 177 | 307 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.1980.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3hh8A02 | 91.14 | 3.40.50.1980 | 131 | 25 | 96 | 1.50 | 1.56 | |
![]() |
1pq4A02 | 85.59 | 3.40.50.1980 | 103 | 20 | 78 | 1.86 | 2.37 | |
![]() |
3cx3A02 | 83.92 | 3.40.50.1980 | 107 | 26 | 80 | 1.85 | 2.29 |
>pdb|1toaA02 LDAYVRRKAQSLPAERRVLVTAHDAFGYFSRAYGFEVKGLQGVSTASEASAHDMQELAAFIAQRKLPAIFIESSIPHKNV EALRDAVQARGHVVQIGGELFSDAMGDAGTSEGTYVGMVTHNIDTIVAALA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"