CATH Domain: 1tkkA01 XML data for domain: 1tkkA01

Molscript image for 1tkkA01
1tkkA01
PDB coordinates for domain 1tkkA01

PDB 1tkk, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.26
3.30.390.10.26.1
3.30.390.10.26.1.1
3.30.390.10.26.1.1.1
3.30.390.10.26.1.1.1.1

[top]
Segment boundaries for domain 1tkkA01

Chopping figure for domain 1tkkA01
DomainStart PDB ResidueStop PDB Residue
1tkkA01 1 115
1tkkA02 116 359

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.390.10.26.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bjsA01 88.07 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 22 93 1.97 2.12
1jpdX01 87.44 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 26 86 1.98 2.30
2qq6B01 85.62 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 19 76 1.94 2.54
2oz8A01 82.86 Mesorhizobium lotiMll7089 protein 3.30.390.10 128 16 82 3.08 3.72
2nqlA01 81.88 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 22 67 2.40 3.57
1yeyD01 78.54 Xanthomonas campestris pv. campestrisRTS beta protein 3.30.390.10 172 20 62 2.90 4.66
3cawA01 78.35 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.30.390.10 91 12 66 2.88 4.36
1stzA03 75.65 Thermotoga maritimaHeat-inducible transcription repressor hrcAHeat-inducible transcriptional repressor 3.30.390.60 89 11 73 3.05 4.18
1i4jA00 74.32 Ribosome50S ribosomal protein L22Large subunit ribosomal protein L22Thermus thermophilus 3.90.470.10 110 7 49 2.39 4.82
2ibdA01 57.16 Rhodococcus jostii RHA1Possible transcriptional regulator 1.10.10.60 45 2 17 0.66 3.79
1t56A01 54.34 TRANSCRIPTIONAL REGULATORY REPRESSOR PROTEIN (TETR-FAMILY) ETHRMycobacterium tuberculosis 1.10.10.60 46 2 16 0.76 4.60
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tkkA01
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMDSIESAIHHVLKPALLGKSLA
GYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tkkA01
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMDSIESAIHHVLKPALLGKSLA
GYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMC
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:46

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"