CATH Domain: 1tkjA00 XML data for domain: 1tkjA00

Molscript image for 1tkjA00
1tkjA00
PDB coordinates for domain 1tkjA00

PDB 1tkj, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.2
3.40.630.10.2.1
3.40.630.10.2.1.1
3.40.630.10.2.1.1.1
3.40.630.10.2.1.1.1.1

Segment boundaries for domain 1tkjA00

Chopping figure for domain 1tkjA00
DomainStart PDB ResidueStop PDB Residue
1tkjA00 1 277

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.40.630.10.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kasA01 83.14 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 15 82 2.62 3.19
1cg2A01 82.13 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 18 85 2.78 3.25
1lfwA01 81.42 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.40.630.10 274 14 81 3.12 3.82
1z2lB01 81.40 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 16 82 3.20 3.88
2v8hA01 81.22 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 12 75 2.67 3.53
1vheA01 81.16 Bacillus subtilisPutative aminopeptidase ysdC 3.40.630.10 268 14 79 3.40 4.26
1y0yA01 81.00 Endoglucanase [EC:3.2.1.4]Starch and sucrose metabolismPyrococcus horikoshiiTetrahedral aminopeptidase 3.40.630.10 254 15 79 3.30 4.14
1xmbA01 80.71 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.40.630.10 274 10 86 3.11 3.59
2qyvA01 80.30 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 15 78 3.57 4.54
1vgyA01 80.11 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 10 82 2.85 3.46
2greA01 80.04 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 9 77 3.69 4.75
3ct9B01 79.75 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 13 74 2.87 3.84
2cf4A01 79.72 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 15 75 3.36 4.43
3ifeA01 78.42 Bacillus anthracisPeptidase TTripeptide aminopeptidase [EC:3.4.11.4] 3.40.630.10 302 14 74 3.22 4.32
2rb7A01 77.95 Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20 3.40.630.10 231 13 75 3.31 4.41
1yloA01 77.95 Shigella flexneriPutative uncharacterized protein 3.40.630.10 254 8 74 3.37 4.51
1vhoA01 77.49 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 3.40.630.10 237 11 76 3.77 4.95
Displaying entries 1 to 17 (page 1 of 1)


Domain ATOM Sequence

>pdb|1tkjA00
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVL
MAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFD
MIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQ
AFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS    

Domain COMBS Sequence

>pdb|1tkjA00
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVL
MAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFD
MIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQ
AFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSSGTGEPPT    

Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:27

Assigning to "3.40.630.10" based on similarity with "1qq9A00" (NWSI: 100, NWO: 100, SPS: 98.82, SPO: 99, RMSD: 0.26)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tkjA00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tkjA00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tkjA00"

Insertion by auto on 09 Mar 2006 09:35

Final ChopClose added based on similarity with "1cp7A" [LEE: 0, LME: 0, MR: 0, LG: 3, SS: 98.63, SI: 100, SO: 100]