CATH Domain: 1tkeA03 XML data for domain: 1tkeA03

Molscript image for 1tkeA03
1tkeA03
PDB coordinates for domain 1tkeA03

PDB 1tke, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.54 Replication Terminator Protein; Chain A, domain 2
3.30.54.20 Gene3D
3.30.54.20.1
3.30.54.20.1.1
3.30.54.20.1.1.1
3.30.54.20.1.1.1.1
3.30.54.20.1.1.1.1.1

[top]
Segment boundaries for domain 1tkeA03

Chopping figure for domain 1tkeA03
DomainStart PDB ResidueStop PDB Residue
1tkeA01 1 64
1tkeA02 65 129
1tkeA02 188 224
1tkeA03 130 187

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.54.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1d2nA02 76.85 Vesicle-fusing ATPaseCricetulus griseusProtein binding 1.10.8.60 67 6 70 3.29 4.69
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tkeA03
KNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tkeA03
KNYDVIKKKVSWHEARETFANRGESYKVSILDENIAHDDKPGLYFHEEYVDMCRGPHV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Nov 2007 14:28

Assigning to "3.30.54.20" based on similarity with "1tjeA03"

Flow stage update by auto on 23 Nov 2007 14:04

No in_process hits for Domain "1tkeA03" ready to be processed

Flow stage update by auto on 23 Nov 2007 14:02

NW result present for Domain "1tkeA03"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "1tkeA03"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "1tkeA03"

Insertion by auto on 12 Nov 2007 19:59

Final ChopClose added based on similarity with "1tjeA"