CATH Domain: 1tkeA02 XML data for domain: 1tkeA02

Molscript image for 1tkeA02
1tkeA02
PDB coordinates for domain 1tkeA02

PDB 1tke, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.980 Threonyl-tRNA Synthetase; Chain A, domain 2
3.30.980.10 Threonyl-trna Synthetase; Chain A, domain 2 Gene3D
3.30.980.10.1
3.30.980.10.1.1
3.30.980.10.1.1.1
3.30.980.10.1.1.1.1
3.30.980.10.1.1.1.1.1

[top]
Segment boundaries for domain 1tkeA02

Chopping figure for domain 1tkeA02
DomainStart PDB ResidueStop PDB Residue
1tkeA01 1 64
1tkeA02 65 129
1tkeA02 188 224
1tkeA03 130 187

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1tkeA02
EEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEPNMRFCHHFKLMKTA
GAYWRGDSNNKMLQRIYGTAWA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tkeA02
EEGLEIIRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEPNMRFCHHFKLMKTA
GAYWRGDSNNKMLQRIYGTAWA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Nov 2007 14:28

Assigning to "3.30.980.10" based on similarity with "1tjeA02"

Flow stage update by auto on 23 Nov 2007 14:04

No in_process hits for Domain "1tkeA02" ready to be processed

Flow stage update by auto on 23 Nov 2007 14:02

NW result present for Domain "1tkeA02"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "1tkeA02"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "1tkeA02"

Insertion by auto on 12 Nov 2007 19:59

Final ChopClose added based on similarity with "1tjeA"