Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1tk5A01 | 1 | 232 |
| 1tk5A02 | 233 | 414 |
| 1tk5A03 | 415 | 477 |
| 1tk5A03 | 590 | 704 |
| 1tk5A04 | 478 | 589 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1tk5A04 GLELRCLAHFMARFDNGEYAHEILNGDIHTKNQIAAELPTRDNAKTFIYGFLYGAIGQIVGAGKERGKELKKKFLENTPA IAALRESIQQTLVESVKWK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"