CATH Domain: 1tjoB00 XML data for domain: 1tjoB00

Molscript image for 1tjoB00
1tjoB00
PDB coordinates for domain 1tjoB00

PDB 1tjo, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.9
1.20.1260.10.9.1
1.20.1260.10.9.1.1
1.20.1260.10.9.1.1.1
1.20.1260.10.9.1.1.1.1

[top]
Segment boundaries for domain 1tjoB00

Chopping figure for domain 1tjoB00
DomainStart PDB ResidueStop PDB Residue
1tjoB00 7 181

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fjcB00 90.12 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 25 89 2.51 2.82
2yw6B00 89.09 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 28 85 1.68 1.96
1nfvA00 88.73 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 18 86 2.95 3.42
2qqyA00 86.97 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 21 76 1.83 2.41
1lkoA01 86.52 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 12 82 3.04 3.69
3kwoA00 86.39 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 23 82 2.53 3.07
1vlgA00 84.76 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 13 86 3.59 4.16
2ib0A01 84.72 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 13 76 2.58 3.37
1nkdA00 70.82 Regulatory protein ropEscherichia coli 1.10.287.230 59 8 32 1.50 4.61
1jm0A00 69.23 1.20.5.420 48 18 27 1.12 4.08
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tjoB00
ARATAGEVEGSDALRMDADRAEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGEAAETAEEVADELAERVQ
ALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATREHTELAENLGDHATAHMLREGLIELEDDAHHI
EHYLEDDTLVTQGAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tjoB00
MSTQKNARATAGEVEGSDALRMDADRAEQCVDALNADLANVYVLYHQLKKHHWNVEGAEFRDLHLFLGEAAETAEEVADE
LAERVQALGGVPHASPETLQAEASVDVEDEDVYDIRTSLANDMAIYGDIIEATREHTELAENLGDHATAHMLREGLIELE
DDAHHIEHYLEDDTLVTQGALE
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:26

Assigning to "1.20.1260.10" based on similarity with "1mojD00" (NWSI: 100, NWO: 100, SPS: 98.58, SPO: 100, RMSD: 0.18)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tjoB00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tjoB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tjoB00"

Insertion by auto on 09 Mar 2006 09:32

Final ChopClose added based on similarity with "1mojA" [LEE: 0, LME: 0, MR: 5, LG: 5, SS: 98.09, SI: 100, SO: 100]