Domain assigned by auto on 28 Nov 2006 18:28
Assigning to "1.10.40.30" based on similarity with "1k62A03"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1tj7A01 | 3 | 107 |
| 1tj7A02 | 108 | 362 |
| 1tj7A02 | 434 | 457 |
| 1tj7A03 | 363 | 433 |
There are 7 matching structural neighberhood comparisons for CATH ID 1.10.40.30.5.1.1.1.1 (SIMAX score < 5)
>pdb|1tj7A03 GYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCLDK
Assigning to "1.10.40.30" based on similarity with "1k62A03"
No in_process hits for Domain "1tj7A03" ready to be processed
NW result present for Domain "1tj7A03"
All required files are present for Domain "1tj7A03"
Beginning processing for Domain "1tj7A03"
another nice set of choppings