CATH Domain: 1tj7A03 XML data for domain: 1tj7A03

Molscript image for 1tj7A03
1tj7A03
PDB coordinates for domain 1tj7A03

PDB 1tj7, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.40 Ribonucleotide Reductase Protein R1; domain 1
1.10.40.30 Fumarase/aspartase (C-terminal domain) Gene3D
1.10.40.30.5
1.10.40.30.5.1
1.10.40.30.5.1.1
1.10.40.30.5.1.1.1
1.10.40.30.5.1.1.1.1

[top]
Segment boundaries for domain 1tj7A03

Chopping figure for domain 1tj7A03
DomainStart PDB ResidueStop PDB Residue
1tj7A01 3 107
1tj7A02 108 362
1tj7A02 434 457
1tj7A03 363 433

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 1.10.40.30.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1furA03 80.02 Citrate cycle (TCA cycle)Metabolic pathwaysFumarate hydratase class IIFumarate hydratase, class II [EC:4.2.1.2]Escherichia coli K-12 1.10.40.30 52 15 71 2.15 2.99
1jswB03 79.99 Nitrogen metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismMembraneProtein binding 1.10.40.30 50 20 69 2.48 3.59
1dofA03 78.58 Pyrobaculum aerophilumAdenylosuccinate lyase [EC:4.3.2.2]Purine metabolismAdenylosuccinate lyase (PurB)Alanine, aspartate and glutamate metabolism 1.10.40.30 56 8 54 1.83 3.33
1j3uA03 78.10 Bacillus sp. YM55-1Aspartase 1.10.40.30 52 17 71 2.41 3.36
1q5nA03 78.09 3-carboxy-cis,cis-muconate cycloisomeraseBenzoate degradation via hydroxylation3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]Metabolic pathwaysAcinetobacter sp. ADP1 1.10.40.30 81 16 83 3.24 3.86
1rj9A01 77.36 Cell division protein ftsYThermus aquaticusProtein binding 1.20.120.140 81 9 60 2.66 4.40
2nyvA02 75.60 Phosphoglycolate phosphatase [EC:3.1.3.18]Metabolic pathwaysGlyoxylate and dicarboxylate metabolismAquifex aeolicusPhosphoglycolate phosphatase 1.10.150.240 64 14 83 3.56 4.28
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tj7A03
GYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCLDK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tj7A03
GYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCLDK
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Nov 2006 18:28

Assigning to "1.10.40.30" based on similarity with "1k62A03"

Flow stage update by auto on 28 Nov 2006 18:22

No in_process hits for Domain "1tj7A03" ready to be processed

Flow stage update by auto on 28 Nov 2006 18:22

NW result present for Domain "1tj7A03"

Flow stage update by auto on 28 Nov 2006 18:22

All required files are present for Domain "1tj7A03"

Flow stage update by auto on 28 Nov 2006 18:21

Beginning processing for Domain "1tj7A03"

Insertion by cuff on 21 Nov 2006 17:28

another nice set of choppings