CATH Domain: 1tiqB00

There are 34 matching structural neighberhood comparisons for CATH ID 3.40.630.30.19.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3k9uA00	89.35	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	24	87	1.59	1.82
	2fiwA00	86.69	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	15	86	1.91	2.20
	1s3zA00	86.66	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	12	85	3.73	4.38
	2fiaA00	86.02	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	10	93	3.28	3.52
	2i79D00	85.90	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	20	91	3.67	4.01
	2ge3B00	85.61	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	20	93	3.44	3.67
	1qsmD00	85.03	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	11	86	3.82	4.42
	3g8wA00	84.95	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	17	92	3.05	3.30
	3d8pB00	84.27	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	17	91	4.21	4.61
	2r1iA01	83.43	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	13	75	3.14	4.14
	1cjwA00	83.26	Ovis ariesSerotonin N-acetyltransferase	3.40.630.30	166	13	89	3.08	3.45
	1n71B00	83.04	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	19	83	2.94	3.53
	1ufhA00	82.40	Uncharacterized N-acetyltransferase yycNBacillus subtilis	3.40.630.30	155	10	86	4.20	4.86
	1q2yA00	82.29	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	18	85	3.32	3.90
	1yreC00	82.28	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	12	84	3.61	4.27
	2pdoA01	81.98	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	17	73	2.42	3.30
	2ozgA01	81.71	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	17	71	2.46	3.44
	2i00C01	81.66	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	13	81	2.86	3.51
	1xebA00	81.42	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	17	85	3.40	4.00
	2qecA00	81.37	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	17	85	4.26	4.97
	1y9kA01	81.36	Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation	3.40.630.30	110	19	64	2.27	3.51
	1y7rA00	81.21	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	19	73	2.48	3.36
	3fbuA00	81.11	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	11	85	3.97	4.64
	2atrA00	81.11	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	20	75	2.90	3.83
	1u6mA00	80.59	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	188	17	80	3.77	4.69
	3eo4A00	80.11	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	13	80	3.66	4.53
	2fl4A02	79.96	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	20	62	2.11	3.40
	3efaA00	79.85	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	14	81	3.19	3.89
	1sqhA02	79.69	Drosophila melanogasterCG14615	3.40.630.30	128	9	68	2.32	3.40
	2hv2A03	79.26	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	148	10	76	3.05	3.99
	2hqyA02	79.24	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	164	6	76	2.75	3.58
	1y9wA01	78.98	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	23	63	2.84	4.48
	1lrzA02	77.70	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	195	9	60	2.12	3.53
	2ozhA01	77.34	Xanthomonas campestris pv. campestrisPutative uncharacterized protein	3.40.630.30	120	10	69	3.43	4.93

>pdb|1tiqB00
SVKKKCSREDLQTLQQLSIETFNDENKAYLESAFNTEQLEKELSNSSQFFFIYFDHEIAGYVKVNIDDAQSEEGAESLEI
ERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKGFVQTGAHSFYGDEEQTDLIAKTLILEHH
H    

>pdb|1tiqB00
MSVKXKKCSREDLQTLQQLSIETFNDTFKEQNSPENXKAYLESAFNTEQLEKELSNXSSQFFFIYFDHEIAGYVKVNIDD
AQSEEXGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLGVWEKNENAIAFYKKXGFVQTGAHSFYXGDE
EQTDLIXAKTLILEHHHHHH