Classification merge by cuff on 16 Jun 2009 15:37
COMMENT: merge 3.30.450.120 -> 3.30.450.30 FINAL: merge superfamilies
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1tgqA00 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMV APDKDYFLIVIQNPTE
COMMENT: merge 3.30.450.120 -> 3.30.450.30 FINAL: merge superfamilies
HomCheck 'Assigned T' domains
HomCheck 'Assigned T' domains
Cut based on decision in database "DomChop" on "cathdb"