Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1tg7A01 | 41 | 395 |
| 1tg7A02 | 396 | 576 |
| 1tg7A03 | 577 | 665 |
| 1tg7A04 | 666 | 685 |
| 1tg7A04 | 862 | 1011 |
| 1tg7A05 | 686 | 861 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1tg7A03 WVPQVPTKGTAPGYSNQETTASSIIVKAGYLVRSAYLDGNDLHIQADFNATTPIEVVGAPSGAKNLVINGKKTQTKVDKN GIWSASVAY