CATH Domain: 1tfiA00 XML data for domain: 1tfiA00

Molscript image for 1tfiA00
1tfiA00
PDB coordinates for domain 1tfiA00

PDB 1tfi, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.19
2.20.25.10.19.1
2.20.25.10.19.1.1
2.20.25.10.19.1.1.1
2.20.25.10.19.1.1.1.1

[top]
Segment boundaries for domain 1tfiA00

Chopping figure for domain 1tfiA00
DomainStart PDB ResidueStop PDB Residue
1tfiA00 1 50

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.20.25.10.19.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2aklA01 80.63 Phosphonate and phosphinate metabolismPseudomonas aeruginosaPhosphonoacetate hydrolase [EC:3.11.1.2]Putative uncharacterized protein 2.20.25.10 43 18 70 2.56 3.66
2gu3A02 78.39 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 63 6 66 2.54 3.81
2js4A01 78.36 Hypothetical proteinBordetella bronchisepticaUPF0434 protein BB2007 2.20.25.10 47 12 64 2.07 3.23
1irxA02 72.00 Aminoacyl-tRNA biosynthesisLysyl-tRNA synthetase, class I [EC:6.1.1.6]Pyrococcus horikoshiiLysyl-tRNA synthetase 2.30.30.300 43 4 78 3.35 4.29
2iv2X01 71.95 Methane metabolismMetabolic pathwaysGlyoxylate and dicarboxylate metabolismFormate dehydrogenase HFormate dehydrogenase, alpha subunit [EC:1.2.1.2] 2.20.25.90 55 2 54 2.69 4.93
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tfiA00
KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tfiA00
KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1tfi000" to "1tfiA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:23

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:47

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"