CATH Domain: 1tf1B00 XML data for domain: 1tf1B00

Molscript image for 1tf1B00
1tf1B00
PDB coordinates for domain 1tf1B00

PDB 1tf1, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.2
3.30.450.40.2.2
3.30.450.40.2.2.1
3.30.450.40.2.2.1.1
3.30.450.40.2.2.1.1.1

[top]
Segment boundaries for domain 1tf1B00

Chopping figure for domain 1tf1B00
DomainStart PDB ResidueStop PDB Residue
1tf1B00 6 183

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 3.30.450.40.2.2.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ia2A02 88.70 Rhodococcus sp. DK17PcaR 3.30.450.40 179 22 92 2.51 2.71
1ysqA00 88.67 Specific transcriptional repressor activityNegative regulation of transcription, DNA-dependentHTH-type transcriptional regulator yiaJEscherichia coli K-12 3.30.450.40 181 28 91 2.64 2.88
1yspA00 88.21 Specific transcriptional repressor activitySequence-specific DNA binding transcription factor activityNegative regulation of gene-specific transcriptionTranscriptional regulator kdgREscherichia coli K-12 3.30.450.40 161 28 90 2.18 2.42
2o0yB02 86.98 Rhodococcus jostii RHA1Transcriptional regulator 3.30.450.40 176 24 92 3.50 3.78
3d3oA00 83.81 Putative transcriptional regulator (IcIR family)Acinetobacter sp. ADP1 3.30.450.40 167 13 93 3.63 3.88
3bjnA00 83.67 Transcriptional regulator, putativeVibrio cholerae 3.30.450.40 151 17 83 3.69 4.42
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tf1B00
YFQGHMDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYPLAEEELM
SIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAIYDDVGSVVAAISISGPSSRLTEDRFVSQ
GELVRDTARDISTALGLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tf1B00
YFQGHMDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYPLAEEELM
SIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAIYDDVGSVVAAISISGPSSRLTEDRFVSQ
GELVRDTARDISTALGLKAHP
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:24

Assigning to "3.30.450.40" based on similarity with "1tf1C00" (NWSI: 100, NWO: 99.4505494505494, SPS: 98.21, SPO: 99, RMSD: 0.39)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1tf1B00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1tf1B00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1tf1B00"

Insertion by auto on 09 Mar 2006 08:42

Final ChopClose added based on similarity with "1tf1A" [LEE: 0, LME: 0, MR: 5, LG: 5, SS: 97.08, SI: 100, SO: 100]