Domain assigned by auto on 28 Apr 2006 19:21
Assigning to "3.50.80.10" based on similarity with "1tc5A00" (NWSI: 100, NWO: 100, SPS: 98.75, SPO: 99, RMSD: 0.30)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1tc5C00 MTIRVMLQAMDQGHLLVNNVDKYVRAGRGVMVYIAFLSDRDSAPITDEALRHAVGVLLHTKIFTHFSPEKMINQPQSLEE CPEMDILIVPQASLGGKVKGRSVQFHQLVAKDVGAALYDRFCHFVRVARGVDESRVDANGAPRSEGDAPKAEGWIKYNSR VISGTFGNRQGLRFESEGPFTHMFDI
Assigning to "3.50.80.10" based on similarity with "1tc5A00" (NWSI: 100, NWO: 100, SPS: 98.75, SPO: 99, RMSD: 0.30)
NW result present for Domain "1tc5C00"
All required files are present for Domain "1tc5C00"
Beginning processing for Domain "1tc5C00"