CATH Domain: 1tapA00 XML data for domain: 1tapA00

Molscript image for 1tapA00
1tapA00
PDB coordinates for domain 1tapA00

PDB 1tap, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.410 Factor Xa Inhibitor
4.10.410.10 Factor Xa Inhibitor Gene3D
4.10.410.10.4
4.10.410.10.4.1
4.10.410.10.4.1.1
4.10.410.10.4.1.1.1
4.10.410.10.4.1.1.1.3

[top]
Segment boundaries for domain 1tapA00

Chopping figure for domain 1tapA00
DomainStart PDB ResidueStop PDB Residue
1tapA00 1 60

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 4.10.410.10.4.1.1.1.3 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tocR01 84.59 OrnithodorinOrnithodoros moubata 4.10.410.10 52 26 85 4.24 4.99
1y62A00 83.57 Conkunitzin-S1Conus striatus 4.10.410.10 56 19 91 3.80 4.15
1dtxA00 83.18 Dendroaspis angusticepsVenom basic protease inhibitor 1 homolog 4.10.410.10 58 20 91 3.65 3.98
1bunB00 82.84 Bungarus multicinctusBeta-bungarotoxin B2 chain 4.10.410.10 61 13 86 3.50 4.03
1tocR02 81.02 OrnithodorinOrnithodoros moubata 4.10.410.10 58 13 86 3.49 4.03
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1tapA00
YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1tapA00
YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1tap000" to "1tapA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"